SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011154 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011154
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-50
Family Calponin-homology domain, CH-domain 0.000000537
Further Details:      
 
Domain Number 2 Region: 204-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.71e-19
Family EB1 dimerisation domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011154   Gene: ENSTGUG00000010816   Transcript: ENSTGUT00000011274
Sequence length 286
Comment pep:known chromosome:taeGut3.2.4:2:113492451:113525950:1 gene:ENSTGUG00000010816 transcript:ENSTGUT00000011274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWGMAVNVYSTSITQETMSRHDIIAWVNDILALNYTKVEQLCSGAAYCQFMDMLFPGCIS
LKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFFDA
NYDGKEYDPVEARQGQDALPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSR
PSSAKKATPSSSASKSDKDLETQVIQLSEQVHSLKLALEGVEKERDFYFGKLREIELLCQ
EHGGENNDLVNRLMEVLYASDEHESHTDEHEGEEQVHEQPQQQDEY
Download sequence
Identical sequences H0ZKN3
ENSTGUP00000011154 ENSTGUP00000011154 59729.ENSTGUP00000011154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]