SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011253 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011253
Domain Number 1 Region: 184-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 156-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 3 Region: 226-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000781
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 126-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000432
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011253   Gene: ENSTGUG00000010914   Transcript: ENSTGUT00000011374
Sequence length 268
Comment pep:novel chromosome:taeGut3.2.4:2:114354859:114357224:-1 gene:ENSTGUG00000010914 transcript:ENSTGUT00000011374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKHFNSSKKPNYSELDTHTVIISPYLYESYPVPIIPQPEILSSVAYNPITVWT
TTGLLPSPLPNDLSPLSGYPSSLGRVSPPPPSDTSSKDHSGSESPISDEEERIQSKLSDP
HAIEAEKFQCSLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
Download sequence
Identical sequences A0A087REA4 A0A091J8G6 A0A091KWP0 A0A091M586 A0A091PBQ5 A0A091RC90 A0A091T7A7 A0A091UDS8 A0A093FCH4 A0A093I2U7 A0A093IZ43 A0A094K3V3 A0A0Q3SZN6 A0A1U7RVZ8 A0A218UIR1 A0A226MJF9 A0A226P4Z3 G1NEB1 H0ZKY0 R0KCR9 U3JTA2
ENSTGUP00000011253 ENSMGAP00000011250 ENSAPLP00000003409 XP_002197227.1.42559 XP_003205092.1.16129 XP_005010256.1.99704 XP_005041921.1.66865 XP_005041922.1.66865 XP_005241469.1.75256 XP_005435843.1.10750 XP_006021274.1.24877 XP_009283870.1.47732 XP_009578393.1.87690 XP_009638652.1.23211 XP_009681395.1.43253 XP_009700063.1.71050 XP_009918468.1.2804 XP_009966039.1.75343 XP_010005115.1.85724 XP_010124004.1.88979 XP_010176203.1.30499 XP_010184562.1.17318 XP_010285168.1.48707 XP_010399496.1.2935 XP_010572691.1.12557 XP_011580874.1.59079 XP_013040438.1.65836 XP_013810205.1.3284 XP_014729838.1.99236 XP_017686398.1.3805 XP_017931870.1.51550 XP_019382617.1.87953 XP_019403438.1.79039 XP_021244264.1.32913 XP_021392246.1.53032 XP_021392247.1.53032 59729.ENSTGUP00000011253 ENSMGAP00000011250 ENSTGUP00000011253 ENSFALP00000006006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]