SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011731 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011731
Domain Number 1 Region: 685-880
Classification Level Classification E-value
Superfamily Sec7 domain 1.83e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 442-625,1184-1530
Classification Level Classification E-value
Superfamily ARM repeat 4.08e-27
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011731   Gene: ENSTGUG00000011368   Transcript: ENSTGUT00000011860
Sequence length 1843
Comment pep:novel chromosome:taeGut3.2.4:2:121657113:121741172:-1 gene:ENSTGUG00000011368 transcript:ENSTGUT00000011860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKAETEKQSPPHGDAKS
GSSTLPPVKSKTSFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGNAPDST
APGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQMEKERHRQQHHLQQSPVSHHE
PESPQLRHIPAQADQLSKDHERELDHSTNDVDKNLQEDTEAENGSDISSAENEQTEADQA
TAAENFSKADGGTYDGESNECEEKAQEIVESIVQEMVNIVVGDVEGTAGGDGTTVSLEDG
SDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPTPGAKFSHILQKDAF
LVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFINAIKQY
LCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSSFDH
KWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMSNVQ
ELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPTEQDSSEIKHPETINRYGS
LNSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQG
MLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSALRMF
LEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVK
NKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSSKQSVASE
KQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGL
QDCDDTEVASLCLEGIRCAIRIACIFNIQLERDAYVQALARFTLLTVSSGITEMKQKNID
TIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSFTGTK
DQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFV
RWLCAVSMDELLSATHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNE
DVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKRNRSPTIRDMVVRCIAQMV
NSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTIVFEKHFPATIDSFQDAV
KCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGWFP
ILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPEQQ
TEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEQLARSGTNCL
ENVVILNGEKFTLEIWDKTCTCMLDIFKTTIPHALLTWRPVGGEFCSGSPSDAKEKLDTI
SQKSVDIHDSMQPRSSDGRPYQPSTGATAAEETSKARPAAKFPEQKLFAALLIKCVVQLE
LIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVHVDTQDQGMYRFLTSQQLFKLLDCL
LESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYMDESRTSA
WEEVQQRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDERFKAHASFYYPL
LCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPPEQESGISKH
Download sequence
Identical sequences H0ZMA8
ENSTGUP00000011731 ENSTGUP00000011731 XP_002197628.1.42559 59729.ENSTGUP00000011731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]