SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012089 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000012089
Domain Number - Region: 93-178
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0836
Family Gonadodropin/Follitropin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012089   Gene: ENSTGUG00000011733   Transcript: ENSTGUT00000012223
Sequence length 184
Comment pep:novel chromosome:taeGut3.2.4:5:30061937:30062491:-1 gene:ENSTGUG00000011733 transcript:ENSTGUT00000012223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRTLYAIGALFLLMGFLLPAAEGRKRNRGSQGAIPPPVKDQPNDSEQMQTQQQSGSRHR
ERGKGTSMPAEEVLESSQEALHITERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYG
QCNSFYIPRHVRKEEGSFQSCSFCKPKKFTTMTVTLNCPELQPPRKKKRITRVKECRCIS
IDLD
Download sequence
Identical sequences H0ZNB3
59729.ENSTGUP00000012089 ENSTGUP00000012089 ENSTGUP00000012089 XP_002200528.1.42559 XP_005417568.1.5688 XP_005479949.1.73095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]