SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012754 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012754
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 4.37e-53
Family Ngr ectodomain-like 0.00089
Further Details:      
 
Domain Number 2 Region: 418-518
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000245
Family Fibronectin type III 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012754
Domain Number - Region: 35-78
Classification Level Classification E-value
Superfamily L domain-like 0.000374
Family Ngr ectodomain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012754   Gene: ENSTGUG00000012394   Transcript: ENSTGUT00000012899
Sequence length 661
Comment pep:novel chromosome:taeGut3.2.4:5:42756737:42758722:1 gene:ENSTGUG00000012394 transcript:ENSTGUT00000012899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWTKMWPADWALLMKSWLIFSLGLYIQVSKTLACPKVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFQEAISLKLLFLSKNHLSSVPVGLPL
DLQELRVDENRIAVISDLAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLSKLKEFSIVRN
SLTYPPPDLPGTHLLRLYLQDNQITHIPLTAFSNLRKLERLDISNNQLRMLAKGVFDNLH
NLRQLTVRNNPWLCDCSIKWVTEWLKFIPASINVRGFMCQGPEQVRGMAVRELNMNMLSC
PTTTPGLPLIITPVPATTMPTTLGPSPSFPPSSSKYNPLTPIIATLPTVPDREDRERVTP
PLSEWIQLSIHFVNDTCIQVNWMSLFTVMAYKLTWVKMGHSLVGGIVHERIISGEKQQSS
LVNLEPKSTYRICLVPLDTYNNYRTGEDTVCSEATTKASFFNGSNIPSSHEQTTSQNLGS
PFLLAGLIGGAVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSI
LEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSNVSDLEHCH
T
Download sequence
Identical sequences H0ZQ68
59729.ENSTGUP00000012754 ENSTGUP00000012754 XP_012429619.1.42559 XP_012429620.1.42559 XP_012429621.1.42559 ENSTGUP00000012754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]