SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000012899 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000012899
Domain Number 1 Region: 883-1062
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-39
Family Ypt/Rab-GAP domain of gyp1p 0.006
Further Details:      
 
Domain Number 2 Region: 1037-1158
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 181-210,308-437
Classification Level Classification E-value
Superfamily PH domain-like 1.24e-28
Family Phosphotyrosine-binding domain (PTB) 0.0062
Further Details:      
 
Domain Number 4 Region: 17-174
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-20
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000012899
Domain Number - Region: 1164-1244
Classification Level Classification E-value
Superfamily Tropomyosin 0.032
Family Tropomyosin 0.0091
Further Details:      
 
Domain Number - Region: 432-493
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0523
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000012899   Gene: ENSTGUG00000012530   Transcript: ENSTGUT00000013047
Sequence length 1281
Comment pep:novel chromosome:taeGut3.2.4:1:69346454:69444345:-1 gene:ENSTGUG00000012530 transcript:ENSTGUT00000013047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPLSHPLEPEPEQQPAPPGEKRFRLWYVGSSCLDRRTTLPMLPWLVAEIRRRGQRQEPGG
APGSGVPAREVLLLLGSPTLRCVPASPGPAAGPGRPASPAPAVFIFEHKAQHIARFIHNS
HDLTYFAYLIKAQPDNPDSPMACHVFRATDPNQATVPDIISSIRQVSKAALKEDAKPSKD
SEDAFYDSQKFEVLYCGKVTVAHKKAPSTLIDDCIEKFSLHERQRLKLLNEQRNNESSLD
LPLCEENVPASPLDSPFEDLDSPNSTSGRAAMFTIGSQTNLTNLANTRGCFPERILEDSG
FDEQQEFRSRCSSVTAVMQRRVHDTSLKIQSRRRHASAPSHVQPSDSEKNRTMLFQVGRF
EVNLISPDTKSVVFEKNFKDISSCSQGIKHIDHFGFICRESVEPGLSQYVCYVFQCASES
LVDEVMLTLKQAFSTAAALQNAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVIQRHL
SSLTDNEQADIFERVQKMKPDNDQEENELVILHLRQLCETKQKTHIHIGEAPSVISNSAI
PEGTTSGGRFKLDILKNKAKKSLTSSLENIFSRGANRMRGRLGSVDSFERCSSLASDRDT
SPGDSPPATPPASPVSSAWQTFPEEGSDSPQFRRRAHTFSHPPSSARRRITFQNGRSLSA
RSPLLRQNGVEAASPVVGVRRALSESESASPGLPSSLSAPSFLKTFCQGSGRLLQHSEME
CSTRHLSHSAFDGEGKKRTSTFCSSESLNAAGATLTPRRISWRRRIFLQVASPMNKSPSK
MQHPDGHDGSELLPLSPLAPPLEEDPLVLVLQNEDGPNKTGERKNSEELQSLWRKAIHQQ
ILLLRMEKENQKLEASRDELQSRKVKLDYDEVGICQKDAINIWDKKLLNCRAKIRCDVED
IHSTLKEGVPKSRRGEIWQFLAVQHRVRHRLPNKQQPPDISYKELLKQLTAQQHAILVDL
GRTFPTHPYFSTHLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEEQAFEM
LKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENDISPSLYAAPWFLT
LFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETSIMGCESFENIVDFLKTTIPD
MTKPQMEKIITQVFEMDISKQLHAYEVEYHVLQDELQENVSPCDEGEPLEKLERANNHLK
RQNMDLLEKLQVAHAKIQSLEASLETVLTRENKMKTVIQSLEQEKITYQKTLEQIVKYLP
AEVLSDCELLLKEVNYNPNNK
Download sequence
Identical sequences H0ZQK9
ENSTGUP00000012899 59729.ENSTGUP00000012899 ENSTGUP00000012899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]