SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015254 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015254
Domain Number 1 Region: 13-75
Classification Level Classification E-value
Superfamily Chromo domain-like 1.59e-23
Family Chromo domain 0.000059
Further Details:      
 
Domain Number 2 Region: 103-138
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000113
Family Chromo domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015254   Gene: ENSTGUG00000014894   Transcript: ENSTGUT00000015502
Sequence length 138
Comment pep:novel chromosome:taeGut3.2.4:Un:124329432:124331817:1 gene:ENSTGUG00000014894 transcript:ENSTGUT00000015502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQSQKTAHESEKSEGSKRKAESDTEDKGEESKPKKKKEESEKPRGFARGFEPE
RIIGATDSSGELMFLMKW
Download sequence
Identical sequences H0ZXA3
59729.ENSTGUP00000015254 ENSTGUP00000015254 XP_002192420.1.42559 XP_010200398.1.23224 ENSTGUP00000015254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]