SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015460 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015460
Domain Number 1 Region: 58-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-29
Family Calnexin/calreticulin 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015460   Gene: ENSTGUG00000015105   Transcript: ENSTGUT00000015721
Sequence length 199
Comment pep:novel chromosome:taeGut3.2.4:Un:126036202:126039945:-1 gene:ENSTGUG00000015105 transcript:ENSTGUT00000015721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFQWDWLCLGVLIISSVTAGMENKENLDADVEVENFDKQSQEADVDRDKSSLEVVYQTP
KPTGEVYFTETFDEGLSGKAVISLLQTAFFKDSVHVCGRWEVEELKENALPGDRGLVLKS
VAKYHAISSMLTKAFVFEDKPLIVQYEVNFQKGIDCGGAYIKLLSSSNDLNLLGTFFDKH
LKLIMFGPNRGGEHYTLHF
Download sequence
Identical sequences H0ZXV8
ENSTGUP00000015460 ENSTGUP00000015460 59729.ENSTGUP00000015460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]