SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015481 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000015481
Domain Number - Region: 65-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0738
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015481   Gene: ENSTGUG00000015133   Transcript: ENSTGUT00000015742
Sequence length 122
Comment pep:novel chromosome:taeGut3.2.4:Un:126166197:126168165:1 gene:ENSTGUG00000015133 transcript:ENSTGUT00000015742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSTRPEAASIEPLGPAGCLCSQRALVQARSSQPTRLTTIISAEDTLTGQVLRCDAIVDLI
HGIQVVSTMRELYLEDSPLELKIHALDSEGNTFSTLAGLVFDWTLVKDPEPDGFSDSHNT
LR
Download sequence
Identical sequences H0ZXX9
ENSTGUP00000015481 ENSTGUP00000015481 59729.ENSTGUP00000015481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]