SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015746 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015746
Domain Number 1 Region: 9-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000000698
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015746   Gene: ENSTGUG00000015405   Transcript: ENSTGUT00000016019
Sequence length 88
Comment pep:novel chromosome:taeGut3.2.4:Un:102804765:102805540:1 gene:ENSTGUG00000015405 transcript:ENSTGUT00000016019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVAAAVRSHFHECPDSHRQFCFHGTCRFLVQEEKPACVCHSGYVGTRCEHADLLAVVAA
TQKKQTITALLVVAVVASALLVTVCVLV
Download sequence
Identical sequences H0ZYP3
ENSTGUP00000015746 59729.ENSTGUP00000015746 ENSTGUP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]