SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017593 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017593
Domain Number 1 Region: 175-241
Classification Level Classification E-value
Superfamily Homeodomain-like 1.37e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 50-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.28e-16
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 20-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000124
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017593
Domain Number - Region: 111-138
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0221
Family LIM domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017593   Gene: ENSTGUG00000017316   Transcript: ENSTGUT00000017995
Sequence length 370
Comment pep:novel chromosome:taeGut3.2.4:8_random:2285422:2325582:1 gene:ENSTGUG00000017316 transcript:ENSTGUT00000017995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSALDPATPFSSLLGRAATPKSVCEGCQRVILDRFLLRLNDSLWHEQCVQCASCKEPLQT
TCFYRDKKLYCKLDYEKLFAVKCAGCLEPIAPSELVMRAQKSVYHLHCFCCCVCERRLQK
GDEFVLKEGQLLCKGDYEKERELLSLVSPALSDSGKSDDEDSICKLGQASGKGAEDGKDH
KRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKK
LARRQQQQQQDQQNTQRLSSAQTNSSSGTGLEGMLNPYTALPPPQQLLGMEQSVYGSDPF
RQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLGTADAGPLQARVGNPIDHL
YSMQNSYFTS
Download sequence
Identical sequences H1A3X9
59729.ENSTGUP00000017593 ENSTGUP00000017593 ENSTGUP00000017593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]