SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000018161 from Taeniopygia guttata 69_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000018161
Domain Number 1 Region: 64-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 147-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 194-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000474
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 110-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000111
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000018161   Gene: ENSTGUG00000018492   Transcript: ENSTGUT00000018969
Sequence length 225
Comment pep:novel chromosome:taeGut3.2.4:Un:69393947:69445231:-1 gene:ENSTGUG00000018492 transcript:ENSTGUT00000018969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQDRKGRNSHNCEHHTPSKDPSCREERAPLSQEGGRRSSRSSELVEKAHGREKPHKCLEC
GKGFRRSLDLIQHQVIHTGERPYECGECGKSFRWSSSLRLHQRFHTGERPFECGECGRSF
SLNSILIQQQRIHTGEKPFECGECGKSFRQRGPLMQHQLIHTGKKPFECGKCGMSFSQKG
HLMQHQRIHTGEKPYECGECGKSFRQSSGLRKHERIPTGEKPYEC
Download sequence
Identical sequences H1A5J5
ENSTGUP00000018161 59729.ENSTGUP00000018161 ENSTGUP00000018161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]