SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001432 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001432
Domain Number 1 Region: 502-594
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.07e-17
Family ADP-ribosylating toxins 0.055
Further Details:      
 
Domain Number 2 Region: 406-466
Classification Level Classification E-value
Superfamily WWE domain 0.0000184
Family WWE domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001432   Gene: ENSCHOG00000001619   Transcript: ENSCHOT00000001625
Sequence length 594
Comment pep:novel genescaffold:choHof1:GeneScaffold_462:2792:30105:-1 gene:ENSCHOG00000001619 transcript:ENSCHOT00000001625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAAVVGEVTQVLCAAGGGLELQELKRRLRNGVGTDALERLLLESGRFAVVQRPAAGGE
AAAAERVVLAASALRLCRAHQGIKASCSGLCAQLHLCKFLVYGACKFQKAGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRRDSSGSVSSDTTSQEESDEICLYHIWKSCSFQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXETYGDPRKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMAHPVTISSSDLEKAYLAYRTPG
SDAQAAMLKFKAGKHEYELDFKAFVQKNLLFGTIRKVCRRPKYVSPQDVKVQQTXXXXXX
XXXXXXXXXXXXXXXXXXXXRIALSSSSEEYQKVWNLFNHTLPFYYVQKIERVQNLALWE
VYQWQKGQMQKRNGGKVVDERQLFHGTSACFIDAICQQNFDWRICGLHSTSYGK
Download sequence
Identical sequences ENSCHOP00000001432 ENSCHOP00000001432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]