SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000004017 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000004017
Domain Number 1 Region: 172-278
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-31
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 2 Region: 296-410
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-25
Family Eukaryotic proteases 0.0026
Further Details:      
 
Domain Number 3 Region: 73-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000655
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000197
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000004017   Gene: ENSCHOG00000004541   Transcript: ENSCHOT00000004555
Sequence length 410
Comment pep:novel genescaffold:choHof1:GeneScaffold_4571:11721:35838:1 gene:ENSCHOG00000004541 transcript:ENSCHOT00000004555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFARMSHLRVLLLMTLMGKATFGFSLMSLLPDLDPDWTPDNYESGYEYYDQTEDTISVPD
NPETPDWYYAEDGPCLSSPCEHGGDCLISGDTFTCSCSAPFSGNRCQNVQNKCKNNPCSR
GECLITQNPPYYRCACKHPYTGPDCSRVVPVCRPNPCQHGGTCSQHKRRSKFTCTCPGQF
RGKLCEIGSDDCYVGDGYSYRGKVSRTVNQHSCLYWNSHLLLQENYNMFMEDAEAHGIGE
HNFCRNPDGDKKPWCFIKVNKAKVKWEYCDVSPCSAQDTADPEASPTEPLTKLPGFDSCG
RTQTAERMIKRIYGGFKSTAGKNPWQASLQTSQQLTVSMPQGHFCGGALIHPCWVLTAAH
CTEIKIKHLKVVLGDQDLKKTEFHEQIFGVEKIVKYSYYNERDGIPHNDI
Download sequence
Identical sequences ENSCHOP00000004017 ENSCHOP00000004017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]