SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000004059 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000004059
Domain Number 1 Region: 721-888
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-32
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 596-678
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000785
Family WWE domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000004059   Gene: ENSCHOG00000004588   Transcript: ENSCHOT00000004607
Sequence length 897
Comment pep:novel genescaffold:choHof1:GeneScaffold_1632:2943:57298:-1 gene:ENSCHOG00000004588 transcript:ENSCHOT00000004607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPEVCCFITKILCAHGGRMALDQLLKKILLSETQLCEVLEVAGPDRFVMLETGGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLCKYSHDILSEENFRI
LKSHELSGLNQEELGVLLIQSDPFFMPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSSNRRG
VAYRGRSKSRDRSFLDSQEFLPSASASTPRSCTSSPDNIDSGSPLDDVKDLTHKFMYLGS
QDSSQPSVSSRPTDLVGTGQVGASHSCSENDSREGLLFGNRFSAFNSTSAANRKGPTSWL
NDQSTEKESLFSENQAASFSGLISVQTPETVTTTKNPGRPSSDLSSNIEGRSGNQDVQLF
SFLNNIIDEMATGTTSMRSLNYKTTSNRQREKSLSRNQDTGTTHGNPQITGKIAEGDQGV
ASVNDSLSDINSTAFSKIDDHGSNICLDHLYKGCLLTNSCSKVHFHLPYRWQMLTANTWM
DLKLMEMIEEAYCDPNNCIISIRHHNINFQEMTCDANPMRRISTPSSMAKLTDSVFTTKW
IWYWKDDSNNWIQYGEDKGNQKTSNINSSYLESWFLSCRRGIVSFQAGSQTYELSFQGMI
QTNIASKTQKDVIRRPKFVSSEDVEQIKKGADSQLAQTPSDALTSKFHPQWDHHCLPING
YELSEINDQTTEYAAISARFKASMKNFKIEKIKKIQNPELLQTFEKKKSKMKLSCEKLLF
FATYRAHLEYICANNFDWTYHGPFETKYGKGNYFTKDAICSHKSCGHEAKNIAMFVARVL
VGDFIEGNMTYIRPPSLYDSCVDVRSNPSIFVIFQKDQIYPAYVIEYTEIDKPCVIS
Download sequence
Identical sequences ENSCHOP00000004059 ENSCHOP00000004059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]