SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006242 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCHOP00000006242
Domain Number - Region: 3069-3138
Classification Level Classification E-value
Superfamily WWE domain 0.00615
Family WWE domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006242   Gene: ENSCHOG00000006962   Transcript: ENSCHOT00000007056
Sequence length 3706
Comment pep:novel genescaffold:choHof1:GeneScaffold_439:4353:155192:-1 gene:ENSCHOG00000006962 transcript:ENSCHOT00000007056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVALDNLQIKENALXXXXXXXXXXXXXXXKLTLKIPWKNLYGEAVVATLEGLYLLVVPGA
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHSGEFIYGLENIVYKDIKPGRKRK
KYKKHFRKPFKGLDRSKDKPKEAKKDTFLEKLATQVIKNVQVKITDIHIKYEDDVTDPKR
PLSFGVTLGELSLLTANEQWIPCILNEAEKNIYKLIRLDSLSAYWNVNCSMSYQGARGQI
LXXXXXXXXXXXXXXXXXXXXFQPISASAKLYMNPYAETELKTPKLDWNIEVQNIAIELT
KPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKYAIDSVLEVHIRRYTLMWS
WSNIKKHRQLVKSYKNAYKNKLTQIKVSEEIQKQIQDLEKNLDVFSIIARQQAQVEVIRS
GQKLRKKNVDTGEKRGGWFSGFWGKKESKKKDEESLIPETIDDLMTPEEKAKLFTAIGYS
ESTHNLTLPKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
EAKLEHWYITGLKQQNIVPSLVTSISDTTSSLLKIEFETNPENSTADQTLVIQSQPVEVI
YDAKTINAVVEFFQSNKRLDLEKITSATLMKLEEIKERTATXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXINSKDQGLQRSANSSLEEIMDKAYDKFDVEIKS
VQLLFARAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKVSGGLPLMHV
RISDQKIKDMLHLINSIPLPQRSPAQSPEKQVSSVPVISYGTKGLLGASLLLDGVESXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVILELTKQQKEEDTIL
VLNVTQLGTEATVRTFDLTAVSYLKRISVDYHEIQGTKKKPLHLISSSDKPGLDLLNVEY
IKADKNGLSFQTTFENTEQTLKVAFSSLNLLLQTQALLSSINYLTTIIPSDGQNMGDAKE
VQIPTEKQEKISALQKVIVSSKDSDIIAFRLFAKLNAFCVIVCDEKNNIAEVKIQGLDSS
LSLQSRKQSLFARLENFIVTDVDPKTVHKKAVSIMGNEVFHFNLDLYPDATKGDSYTDMS
KVDGVVSLNVGCIQIVYLHKFLMSLLNFLNNFHVAKEALSVATAQATEKAATSVKDLAQR
SFRVSINIDLKAPVIVIPQSSVSTSAVVVDLGLIRVQNQFGLVSGEDCLNPPVIDRMDVQ
LTKLKLSRTVIQPDISHPDIQLLHPINLDFSVNRNLAASWYHKVPVVEIKGHLDSMNVSL
NQEDLNLLFRILVENLGEATEDLVKEKTRKQETGEIKELLEIAISQQNVCASQDTLTAGV
EEIRSVDIINLLLNFEIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSKGEPLYIINSSNITDEPLLKMLLTKADSDGPEFKTIHDNTKQRVKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSNVLQD
DMFDLKATVELNAFNVFVCDQKCNIADIRIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTILQAGLPQHDIEILK
TVNMLLSIQRNLAATWYVQTPGMEIKGKLKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXQEGMTDPKLSMDQNITLQFDFHFESLSIILYNNDI
NQNSRLGELRLHLMTSAGKMFKDGSMNISIKLKTCTLDDLREGIDRPTSRMIDRKNDQDN
SSMIDINYKQGKNGSQIDAILDKLYVCASVEFLMTVADFFIKAVPQSPKNMAKETQIPLR
QTATAKFKIEKDDPVRPNMTLKAMITDPEVVFVANLTKADAPALTASFQCNLSLSTSKLE
QMMEASVRDLKVLACPFLREKRGKNITTVLQPCSLFMEKCTWASGKQNINIVVKEFIIKI
SPIILNTVMTIMAALSPKTKEDESKDTSKEMENLWDVKSINDYNSWFLGVDMAKEITENF
KDIERPLIEENCAVVVESVQVTLECGLGHRTVPLLLAESTFSGLIKNWTSLMAATAHMTL
EVHYYNETHAVWEPLIERVEEKKQWNLRLDVKKNPVHDKSLMPGDDFCFLPEPMAIHISS
DTMNITISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHGYTEVANIP
VARPGRRLYNVRNPSASHSDSVLVQIDATEGNKVITLRSPLQIKNHFSIAFIIYKFVKNV
KLLERIGVARPEEEFHVPLDSYRCQLFIQPAGILEHQYKESTTYITWKEELXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGTAETHELAEGSTADVLQSRISGEIMELVLVKYQGKNWSGHFRVCDTLPEFFLVCFSCD
STEVMTVDLSIHVRQIGSRMVLSVFSPYWLINKTSRVLQYRSEDIHVKHPADFRDIILFS
FKKKNIFSKNKXQLKISTSAWSSSFSLDTVGSYGCVKCPANNMEYLVGVSIKMSSFNLSR
IVTLTPFCTIVNKSSLELEVGEIAPNGSMPTNKWNYIASSECLPFWPENLSGKLCVRVVG
CERSSKPFFYNQQDNGTLLSLEDLNGGILVDVNIAEHSTVITFSDYHEGAAPALIINHTP
WDILTYKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDECGQFPYD
ANIQIHWVSFLDGRQRVLLFTDDVALVSKARQAEEMEQADHEITLSLHSLGLSLVNNESK
QEVSYIGITSSGVVWEMKPKQKWKPFSQKQILLLEQSYQKYHVSRDHGWIKLDNNFEVNF
DKVPMEMRFPIWCPIKRDFLSGIQIEFKQSPHQRSLRARLYWLQVDNQLPGAMFPVVFHP
VAPPKSIALDSEPKPFIDVSVITRFNEYSKVLQFKYFMVIQEMALKVDQGLGAIIALFTP
TTDPEAERKRTRLIQQDVDALNTELMETSMTDISILSFFEHFHISPVKLHLSLSLGSGGE
GSDKKNQEIIAIHSVNLLLKSIGATLTDVDDLIFKLAYYEIRYQFYKRDQLMWSVVKHYS
EQFLKQMYVLVLGLDVLGNPFGLIRGLSEGVEALFYEPFQGAVQGPEEFAEGLVIGVRSL
FGHTVGGAAGVVSRITGSVGKGLAAITMDKEYQQKRREEMGRQPKDFGDSLARGGKGFLR
GVVGGVTGIITKPVEGAKKEGAAGFFKGIGKGLVGAVARPTGGIIDMASSTFQGIQRVAE
STEEVSSLRPPRLIQEDGIIRPYDRQESEGYDLFENHIKKLEGESYRFHCAIPGSKKTVL
MVTNRRVLCIKEIEILGHMSIDWQCQFEDFVFPPNVSENLLKISVKDQVLFRKDSNNRGY
VRKVYLQDTTTAEKACKAIEAWSMSHQQKLVKQSSLKLLRAPIPSY
Download sequence
Identical sequences ENSCHOP00000006242 ENSCHOP00000006242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]