SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006752 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006752
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-33
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 2 Region: 136-241
Classification Level Classification E-value
Superfamily PH domain-like 0.0000007
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006752   Gene: ENSCHOG00000007627   Transcript: ENSCHOT00000007649
Sequence length 347
Comment pep:novel genescaffold:choHof1:GeneScaffold_6392:675:82279:-1 gene:ENSCHOG00000007627 transcript:ENSCHOT00000007649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYMREATPYVKKGSPVSEIGWGILPPESPRLGVGSADPLSPQPFSFHRDRKSIPLKMCYV
TRSMALADPENRQLEIHSPDAKHTVILRSKDSATAQAWFSAIHANVSDLLSRVIAEVREQ
LGKTDIAGSREIRHLGWLAEKVPGESEKQWKPALVVLTEKDLLIYDSMPRRKEAWLSPVH
TYPLLATRLVHSGPGKGSPQAGMDLSFATRTGTRQGIETHIFRAEISRDLSHWTRSIVQG
CHNSAELITEITAACTYKNQECRLTIHYENGFSITTEPQEGAFPKTIIQSPYEKLKMSSD
DGIRMLCLDFGGKDGEIQLDLHSCPKPIVFIIHSFLSAKITRLGLVA
Download sequence
Identical sequences ENSCHOP00000006752 ENSCHOP00000006752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]