SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008048 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008048
Domain Number 1 Region: 308-362
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000998
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000008048
Domain Number - Region: 35-67
Classification Level Classification E-value
Superfamily WWE domain 0.00301
Family WWE domain 0.0093
Further Details:      
 
Domain Number - Region: 212-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0514
Family Hypothetical esterase YJL068C 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008048   Gene: ENSCHOG00000009096   Transcript: ENSCHOT00000009122
Sequence length 633
Comment pep:novel genescaffold:choHof1:GeneScaffold_969:495:22714:1 gene:ENSCHOG00000009096 transcript:ENSCHOT00000009122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDYNGRVVPTDGGRYDVHLEERLRYAVYWDETASEVRRCTWFYKGDKDNKYVPYSESFSQ
KLEETYMLAVTLDEWKKFSPNREIIILHNPXSVAGSDEWGSTPTEQGRPRTVKRGVENIC
VDIHYGEPLQIDHLVFVVHGIGXXXXXXXXXXXXXXNDFRSVSLNLLQTHFKKAQENKQI
GRVEFLPVNWHSPLHSTGVDVDLQRITLPSINRLRHFTNDTILDVFFYNSPTYCQTIVDT
VTSEMNRIYTLFLQRNPDFKGGISIAGHSLGSLILFDILTNQKDSLGDIDSEKGSLNIVM
DQGDTLTLEEDLKKLQLSRFFCIFEKEQVDKEALALCTDKDLQEMGIPLGPRKKILNYFR
TRKNSKGINRSTLHSASGASVSDIPKESEFHSSTDDTQNDECLDVGIGQVSVKYPQLIYK
PEIFFAFGSPIGMFLTVRGLKRIDPNYKFPTCKGFFNIYHPFDPVAYRIEPMVVPGVEFE
PMLIPHHKGRKRMHLELKEGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQASETVEET
ETEPESSSEKPSDVNIEETSVAVKEEVPPINVGMLNGGQRIDYVLQEKPIESFNEYLFAL
QSHLCYWESEDTVLLVLKEIYQTQGIFLDQPLQ
Download sequence
Identical sequences ENSCHOP00000008048 ENSCHOP00000008048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]