SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009134 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009134
Domain Number 1 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 2e-37
Family Link domain 0.00000219
Further Details:      
 
Domain Number 2 Region: 134-220
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-27
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009134   Gene: ENSCHOG00000010318   Transcript: ENSCHOT00000010342
Sequence length 221
Comment pep:novel genescaffold:choHof1:GeneScaffold_2823:4565:16717:1 gene:ENSCHOG00000010318 transcript:ENSCHOT00000010342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILVYLFFLLWEETHGWGYKNGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGSNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQICYWHIRLTYGQRIHLSFLDF
DLEDDPACLADYVEIYDSYDDIHGFVGRYCGDELPEDIIST
Download sequence
Identical sequences ENSCHOP00000009134 ENSCHOP00000009134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]