SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009356 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009356
Domain Number 1 Region: 656-834
Classification Level Classification E-value
Superfamily Macro domain-like 1.01e-54
Family Macro domain 0.0000691
Further Details:      
 
Domain Number 2 Region: 1053-1249
Classification Level Classification E-value
Superfamily Macro domain-like 4.37e-39
Family Macro domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1498-1652
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.93e-37
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 4 Region: 1346-1453
Classification Level Classification E-value
Superfamily WWE domain 2.88e-19
Family WWE domain 0.0056
Further Details:      
 
Domain Number 5 Region: 960-1041
Classification Level Classification E-value
Superfamily Macro domain-like 5.05e-16
Family Macro domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000009356
Domain Number - Region: 78-152
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00528
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009356   Gene: ENSCHOG00000010569   Transcript: ENSCHOT00000010603
Sequence length 1653
Comment pep:novel genescaffold:choHof1:GeneScaffold_6472:1460:40182:1 gene:ENSCHOG00000010569 transcript:ENSCHOT00000010603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQKVLERENHELIWPEKGTFKLTVQLPTAPDEIHGISKEENPQKESKTKDDSEKPDIMKF
IEDCSKHRTLKQLQLSPRLLEVTKTIRIENLPPGVDDYYLKLFFENPDNGGGRVASVQCF
QEESSALIEFFDRKVLDVILTKKLVFNKMPLSVFPYYTSLGTALYGKEKPLIKLPAPLVK
PLALPIWKFLQKKSHLMEKINDEMGLWHCELVWPQLNCEVTIRPAATLINKERRRIKTWS
EDASRAFLGIMSNYKFVLFNVDPTVWDTIKNDLEDDRILLEYDMLEEMITIVGKSEDVQI
IEPQVNRLIESIIQKIKREQESLKEKLAVDPGKYFLLCQSGVLECLLLECPDMEISYDAA
THYLCFKGLRANVYKVKCEIQEKVHAMAQKNIQIASEVCQFLKQVDCEEFSKSLFIAKKI
LAIYELKGTAVLLTSSSSEVLLEAEKQMVNSLIYKHIEVEDGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFQDKARYYKSEVKRLFGCFIELQENEEKEKAGSTGGKRVFSRTELAAGVLL
IVQQGDLTRFPVEVIVNAANEELKHSGGLALALLKAAGPELQADCDQIVKRKGNIRPGNA
AISKAGRLPYKQVIHAVGPRWKKDEGVRCERLLKKVVEESLDLAEEHKYKSIAIPAISSG
VFGFPLDQCVRTIALAIKEYFQYNSDRHTLKEIYLVDTAEKTVEAFAEAVKTLFRDTRPD
KAPLLSLPAAAAPLETKQEILVSPEGLRILLVIGDVQDAKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXM
MEDIINECLKTTESLFLESITFPAIGTGNLGFPKTIFAELIISEVFKFSNKNQLTNLKEV
HFLLHPSDHGNIQAFADEFSKRANGKLVSDKTPKAKSTPGFYGTISNPDLGVHEMKIGPI
VFQVASGDITKEEVDVIVNSTSKTFNLKVGVSKAILEGAGQDVETECARQAQQGNKNYVI
TDGGLLKCKKIIHVIGGDNVKKSISCVLQECEKWNYSTVCLPAIGTGKAQKDPDQVADAI
MDAIEDFIQKGSVQTLKKVKVVIFLPQVLDVFYASMRKREGSQASSQPSMISKFASLVGL
SWQSPKKQNPLILKKTESAIFQVCGENEKSVENTISWLQDLIKNEQFTYINQDDCIKNFE
EKEYQELNMLQKNLNITISLDRKKPLIEVLGISRDVIKATSTIEGMIKRVRLDKEKESRA
DCISEFIEWQYNDSNTFQPFDKMTNLQLEDARRAKRKTISVKINNQSYTVDLNTNTATDG
RGHSLPVQRLTKSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
ERVQNPDLWNSYQAKKKIMDAKNGQTQNEKFLFHGTDASSLPHVNTNGFNRSYAGKNAVA
FGKGTYFAVHASYSANDTYSRPDGNGKKYMYYVRVLTGIYTLGNHSLIVPPSKNPQNPTD
LYDTVTDNLQNPSLFVVFYDYQAYPEYLITFKR
Download sequence
Identical sequences ENSCHOP00000009356 ENSCHOP00000009356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]