SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009732 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009732
Domain Number 1 Region: 128-328
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.19e-41
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.05
Further Details:      
 
Domain Number 2 Region: 16-102
Classification Level Classification E-value
Superfamily WWE domain 1.07e-17
Family WWE domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009732   Gene: ENSCHOG00000010998   Transcript: ENSCHOT00000011021
Sequence length 328
Comment pep:novel genescaffold:choHof1:GeneScaffold_1968:14988:35070:-1 gene:ENSCHOG00000010998 transcript:ENSCHOT00000011021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHKAEEFFSKTTDSEMDEMDTSDTQWGWFYLAECGKWHMFQPDTNFQCSVSSEDIEKSF
KTNPCGSISFTTAKFSYKIDFAEMKQMNLTTGKQRLIKRAFSISAFSYICENEAIPMPPH
WENVNTEMPYQLIPLHSQTHEYNEVASLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQL
KKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGALFGKXXXFARDAAYSSRCD
DIKHGNTFQIHGVSFQQRHLFRTHKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDS
CVDDTWNPKIFVVFDANQIYPEYLIDFQ
Download sequence
Identical sequences ENSCHOP00000009732 ENSCHOP00000009732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]