SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009935 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009935
Domain Number 1 Region: 550-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-18
Family Classic zinc finger, C2H2 0.00066
Further Details:      
 
Domain Number 2 Region: 363-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-16
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 475-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 436-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000321
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009935   Gene: ENSCHOG00000011227   Transcript: ENSCHOT00000011260
Sequence length 726
Comment pep:novel genescaffold:choHof1:GeneScaffold_1452:7272:23042:1 gene:ENSCHOG00000011227 transcript:ENSCHOT00000011260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGSEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGAVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQGIPPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSQCGNFRQKQLLDMH
FKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGIEGENGGETKKSKRGRKRK
MRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPEPVTPTPPPAKKRRGRPPGRTNQ
PKQTQPTAIIQVEDQNTGAIESIIVEVKKEPDAEPVEGEEEETQPAAPDAPNGDLTPEMI
LSMMDR
Download sequence
Identical sequences ENSCHOP00000009935 ENSCHOP00000009935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]