SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010986 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010986
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 54-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 414-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.06e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010986   Gene: ENSCHOG00000012411   Transcript: ENSCHOT00000012441
Sequence length 463
Comment pep:novel genescaffold:choHof1:GeneScaffold_200:2337:12473:-1 gene:ENSCHOG00000012411 transcript:ENSCHOT00000012441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRPRGATAPRAAGGAVAAGLGPNEAAALPHQESVPQDRNQEEDSSALKILKVMSLGSVL
FSDVAVVFSQEEWEELVPAQKALYRDVMLETFSNLVSLGVASKPDVIAFLEQGEEPWTVE
RGAAPGGPGPVLESGYDTEVPSPKQHFYEVASPQWEIMESLASYDLECSRLQDDWECRGQ
SDRQQRNPDEHFSQMIISHEEIPAFGQQTSITFYQKIHTEEKPYGYNECRKDFWQEEFLN
NHQGIHSSEKPYKCKECGKAFKYGSRLIQHENIHSGKKPYECNECGKAFNSGSNFIQHQR
VHTGEKPYECKDCAKAFSRSSQLIEHQRIHTGEKPYQCKECGKAFNRFSHLKVHYRIHTG
EKPYACKECGKTFSHRSQLIQHQTIHTGKKLYECKECGKAFNQGSTLIRHQRIHTGEKPY
ECKVCGKTFRVSSQLKQHQRIHTGEKPYQCKVCGRAFKRVSHL
Download sequence
Identical sequences ENSCHOP00000010986 ENSCHOP00000010986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]