SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000000334 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000000334
Domain Number 1 Region: 340-441
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.35e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.3e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 156-209
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000447
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000000334   Gene: ENSCHOG00000000376   Transcript: ENSCHOT00000000382
Sequence length 626
Comment pep:novel genescaffold:choHof1:GeneScaffold_3360:4822:31832:1 gene:ENSCHOG00000000376 transcript:ENSCHOT00000000382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSSSLGTSSVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKPMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTRDKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXGGILEIHRIRGSSPSSCGSSPLNITSTPPPDVSSPGGKKI
LNGGTPDIPSSGLLPGQAQENPGYPYSDSSSILGENSHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences ENSCHOP00000000334 ENSCHOP00000000334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]