SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003183 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003183
Domain Number 1 Region: 690-844
Classification Level Classification E-value
Superfamily C-terminal autoproteolytic domain of nucleoporin nup98 3.14e-55
Family C-terminal autoproteolytic domain of nucleoporin nup98 0.0000000431
Further Details:      
 
Domain Number 2 Region: 26-155
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000271
Family Tetraviridae-like VP 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003183   Gene: ENSCHOG00000003579   Transcript: ENSCHOT00000003604
Sequence length 1774
Comment pep:novel genescaffold:choHof1:GeneScaffold_1940:3757:68084:-1 gene:ENSCHOG00000003579 transcript:ENSCHOT00000003604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTNSFSQPATSTSTGFGFGTSTG
TSNSLFGTASTGTSLFSSQNNAFAQNKPSGFGNFGTSTSSGGLFGTANTTSNPFGSTSGS
LFGPSSFTAAHTGTTIKFNAPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTGF
GTNAGGLFGQQNQQTTSLFSKPFGQATTTQNSGFPFGNTSTLGQPSTNTMGLFGVTQASQ
PGGLFGTATNTSTGTAFGTGTGLFGQTSTGFGAVGSTLFGNNKLTTFGTSTTSAPSFGTT
SGGLFGFGSNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTG
AFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPM
SDPKKKEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVLTKDGFYTIPYMDDLAKITNEKGECIVS
DFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVIVYLDDNQKPPVGEGLNRKAEVTL
DGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKY
GLQDSDEEEEERPSTTSSKKLKTAPVPPTGQATPFQMALNGKPAPPTQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMKASLLADEE
DVDMVLDERFNRLPSKADSSQEICSPRLPISASHSSKSRSLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXITESPFKVHLEKLSLRQRKLNEDLQLYQTPLELKLKHSTVYVDELCPLIVPNPGV
AVIHDYADWVKEASGDLLEAQIVKHWSLTWTLCEALWGDLKELENHLDEPSEYIQMLERR
RAFSRWLSQTASPQIEVEVFSTQKESPVEAVFSYLTGKRISEACCLAQQSGDHRLALLLS
QLVGSQSVRELLTMQLADWHQLQADNFIQEERLRIFTLLAGKPVWQLSEQKQINVCSHLD
WKRSLAVHLWYLLPPTASISRALSMYEEAFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXHYDLSQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSEQ
CEGVLQASYAGQLESEGLWEWAIFVLLHITNSXXXXXXXXXLLTRHCQLLKTPESWAKET
FLTQKLCVPAEWIHEAKAVRAHMDSDKHLEALYLFKAGHWNHCHKLIIRHLASDAIINEN
YDYLKGFLEDLAPPERSSLIHDWDTLGLVYLDYIQVIEMLHHIQQVDCSGYELEQLHTKV
TSLCNRIEQIQCYNAKDRLAQSDMAKRIANLLRVVLSLQHAPDATSDSTPDPRQVPLRLL
APHIGRLPMPEDYALEELRSLTQSYLRELTVGSQ
Download sequence
Identical sequences ENSCHOP00000003183 ENSCHOP00000003183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]