SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003544 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003544
Domain Number 1 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-20
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 2 Region: 491-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.37e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 590-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 667-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 805-857
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 61-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000222
Family KRAB domain (Kruppel-associated box) 0.0029
Further Details:      
 
Domain Number 8 Region: 706-757
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000774
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 9 Region: 295-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000731
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000003544
Domain Number - Region: 456-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00312
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 773-816
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0655
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003544   Gene: ENSCHOG00000004002   Transcript: ENSCHOT00000004021
Sequence length 860
Comment pep:novel genescaffold:choHof1:GeneScaffold_7101:6049:11183:-1 gene:ENSCHOG00000004002 transcript:ENSCHOT00000004021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPSSPLRSDSGLGNHLEPPYGTGVRDFLAGQSDPAAAQVPDLSPRERYPGDQVVATGPLT
VQPQKPMTFRNIEVTFPQEEWGGLGPAQRNLYRDVMLEKYRMASLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAQSVSEG
MGIREYFAQKSRLKGQKGDSIGVCVKQEETNVSHVTGKESEELGESDSRDLNHVSYFRVP
GRRQSLKHGYGRHFRLSSHLCDYKEYGKGLRHMIGGVSLCQRLHAGPKGNEKDDGKDFSL
SSHHQHGQSLHAVETLYRCSDCGRTFSHSSRLACHQRLHTQEKPFKCRVCGKAFRWNSNC
VRHEKIHSGVKPYKCSLCEKGFIRLSAYRLHQETHTKQTCVESNQYGEAFTYDSGLDHHL
RDYSGEKPFDCSQCGKSFHCKSYILEHQRIHTQEKPFKCTKCRKTFRWRSNFTRHRRLHQ
FHEQDKCREDFRQSSNCSQPQKVPTVEKTFPCQQCGKTFTRKKSLIDHQRIHTGEKPYQC
SECGKEFTYRSGFIVHKKQHAITRKPEVGLSFSQDRVFQAPQSSDTMEEPFKCSHCGKDF
RNRSFLLIHLRVHTREKPYQCRECGKAFRWSSNLSRHQRSHSLGKHYKYHEYHKTPDLQP
KILTGEKPFWCQECGKTFTRKRTLLDHKGIHSGEKRYKCNVCGKSYDRNYRLVNHQRIHS
KERPFKCQWCGKDFTGRHTLRVHQRKHARSAQSECSPSGLSSCQDTRLSLQESRPSGEKP
LNKCEEACNQSSRFTGLQNIPVRKKCHKCNICGKTFPKGSQLISHKRFHTRERPFKCREC
GKTFRWSSNLARHMKNHIRD
Download sequence
Identical sequences ENSCHOP00000003544 ENSCHOP00000003544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]