SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003810 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003810
Domain Number 1 Region: 49-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000208
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 187-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000317
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 94-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000276
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 128-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000296
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003810   Gene: ENSCHOG00000004304   Transcript: ENSCHOT00000004321
Sequence length 479
Comment pep:novel scaffold:choHof1:scaffold_48521:5707:9911:-1 gene:ENSCHOG00000004304 transcript:ENSCHOT00000004321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL
PHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH
DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR
RVARGAKEKKHPCDHCDRRFYTRNDVRRHLVVHTGRKDFLCQYCAQRFGRKDLTRHVKKS
HSQELLKIKTEPVDMLGVLSCSSTVSVKEELSPVLCMASRDVMGAKAFPGMLPMGMYGAH
IPTMPSTGMPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVDS
FLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLTKSPANLSEALCAANVDFSHLLGFL
PLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGSLHSLPPVTS
Download sequence
Identical sequences ENSCHOP00000003810 ENSCHOP00000003810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]