SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000004538 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000004538
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 335-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 473-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 180-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000662
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000004538   Gene: ENSCHOG00000005126   Transcript: ENSCHOT00000005140
Sequence length 593
Comment pep:novel genescaffold:choHof1:GeneScaffold_7105:9268:13635:1 gene:ENSCHOG00000005126 transcript:ENSCHOT00000005140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPVTFRDVAVDFTQEEWGLLGPAQRTLYHDVMLETFGHLASVGPWVPKLDIVAQPECGAE
LWVTGREFPQEPYPKEEPSQESTAERLMGRLLGEVWDQEAQVHTLTRSQAVLWKQVPTAV
GDVPERDFPPRSTLLTQLSIPADEDSQERHLKAFQPNEIITKHQRMCAGGNPFRSDEHRK
YSQLEKQRRADAGEDLFVCGECGKAFSQSSSLTLQRLRDTRENANRCYECGKAFTCAILI
EHQELHTGTKLSFFCRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKPYKCNECGKAFTCHSSLTVHEKIHN
GDKPFKCNECEKAFNNRSRLTLHQRIHTGEKPFKCNACGKGFSCHSYLIVHQRIHSGEKP
FKCNECGKAFSSHSYLIVHQRIHTGEKPFDCSKCWKAFSCHSSLIVHQRIHTGEKPYKCN
ECGKAFSQNHCLIKHQKIHSGEKSFKCNECGEMFNWSSHLTEHQRIHNEEKPFPIQFNKH
LLSSYYMPSSLLGAGATGVSDVDPINAMDVAKLLCVVQASPSRNFPVGSKPGN
Download sequence
Identical sequences ENSCHOP00000004538 ENSCHOP00000004538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]