SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006274 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006274
Domain Number 1 Region: 114-321
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-25
Family Nuclear receptor ligand-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 66-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-17
Family Nuclear receptor 0.00074
Further Details:      
 
Domain Number 3 Region: 364-399
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000131
Family Nuclear receptor ligand-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006274   Gene: ENSCHOG00000007068   Transcript: ENSCHOT00000007093
Sequence length 399
Comment pep:novel genescaffold:choHof1:GeneScaffold_263:3612:10319:1 gene:ENSCHOG00000007068 transcript:ENSCHOT00000007093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMTRLTAPMSSSVAAAAPAAVAVSRKESPGRWGLGEDLPXXXXXXXXXXXXXXXXXXXXX
XXXXXGCSGFFKRSVRRRLTYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQN
ERQPRSTAQVRLDSLRTDTESQPEPLGATPLPSGPSSKDSMPVSAARALGHHFVTSLIMA
ETCAKLEPGDADENIDVTSNDPEFPSTPHSSSSFPCGLDSIHEMSARLLFMAVKWAKNLP
VFSDLPFRDQVILLEEAWSELFLLGAIQWSLPLESCPLLAPPEVSATSGSQGRLVLSSIE
TRTLQTISRFRALAVPEFACMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXFGKLLLLLPSLRFIAAERIELLFFRKTIGNTPME
Download sequence
Identical sequences ENSCHOP00000006274 ENSCHOP00000006274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]