SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006814 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006814
Domain Number 1 Region: 805-921
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-23
Family Protein kinases, catalytic subunit 0.00089
Further Details:      
 
Domain Number 2 Region: 353-478
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-16
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 3 Region: 80-213
Classification Level Classification E-value
Superfamily Second domain of FERM 6.59e-16
Family Second domain of FERM 0.0041
Further Details:      
 
Domain Number 4 Region: 548-638
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000407
Family Protein kinases, catalytic subunit 0.0039
Further Details:      
 
Domain Number 5 Region: 980-1009
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000148
Family Protein kinases, catalytic subunit 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000006814
Domain Number - Region: 325-357
Classification Level Classification E-value
Superfamily PH domain-like 0.00184
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number - Region: 749-785
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00753
Family Protein kinases, catalytic subunit 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006814   Gene: ENSCHOG00000007686   Transcript: ENSCHOT00000007715
Sequence length 1037
Comment pep:novel genescaffold:choHof1:GeneScaffold_5357:76928:132340:-1 gene:ENSCHOG00000007686 transcript:ENSCHOT00000007715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQISPLCHNLFALYDENTRLWYAPNRTITVDNKTLLRLHYRMRFYFTNWHGTNDSEQSVW
RHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIEN
ECLGMAVLAISHYAMMKKVQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDF
LKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETPMLLISSENEMNRLHSNDS
NILCYEVMVTGNLGIQWRHKPNVVPIEKEKNKLKRKKLENKHKKDEEKNKIREEWNNFSY
XXXXXXXXXXXXXXXXXXXXXXXXELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVA
PPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCFEKSEQV
LGGQKQFKNFQIEVQKGRYSLHGSDHSFPSLGDLMNHLKKQILRTDNISFVLKRCCQPKP
REISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQXXXXXXXXXXXXXXXXXXXXXXX
EGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEE
FVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKL
EEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVK
SLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYL
PKNKNKINLKQQLKYAVQICKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDSSPMACL
KMIPTHQMTVRLVNTLK
Download sequence
Identical sequences ENSCHOP00000006814 ENSCHOP00000006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]