SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007585 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007585
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000247
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000184
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007585   Gene: ENSCHOG00000008573   Transcript: ENSCHOT00000008596
Sequence length 614
Comment pep:novel genescaffold:choHof1:GeneScaffold_7748:118680:134856:-1 gene:ENSCHOG00000008573 transcript:ENSCHOT00000008596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPAAPSGEVTSSGGSPGGSTAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNATEKLQAPGKGLTSSKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVTRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPITQLSQAVSQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPAST
GQSPMSGPFIPAAPVKTALPAGPQPPPQPQPQLPTQPQAQKRRFTEELPDERESGLLGYQ
HGPIHMTNLGTGFSSQSEIEGAGTKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNG
SGTLTGSHDYPAKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSS
QPRAKQQMPFWMAP
Download sequence
Identical sequences ENSCHOP00000007585 ENSCHOP00000007585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]