SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007638 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007638
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-20
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 235-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.64e-19
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 297-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 179-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000151
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 339-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000143
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007638   Gene: ENSCHOG00000008629   Transcript: ENSCHOT00000008657
Sequence length 427
Comment pep:novel scaffold:choHof1:scaffold_14527:7133:12131:1 gene:ENSCHOG00000008629 transcript:ENSCHOT00000008657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLESVTFKDLAIDFTCEEWALLDTSQRKLFRDVMLENISHLVSLETGYQLCKSDVTSQ
LEQGEELWRDGLGFLHGQSPGMERDLKKQELISMQHIYRKDTSTILSKVSFMYMNPGHVY
RTQLHKCGLYLVFETSIQNNLALQLYKRIYACKKYLSRNSLSIHIGKDQFKCNDLEENFI
HSSTLTQYISTHTGKKPCVSKQFRKALSDRSSFNRHKHIHTRNKSFDCHICGKDFRRSYV
LRQHERTHTGEKPYACHICGKAFSQSSKLRQHERIHTGQKPYPAMWESLQSIHDRTHTGE
KPYGCHLCGKTFSQCSTLRKHERTHSGEKTCECHLCGKAFSQYSTLRQHKSTLIGEKPYE
CHACGKDFTNSSHIMHTGEKTNVIASSLVCTRKNSRKLLKHEIRGECLYGKPFTYRAKFI
IYVRFYV
Download sequence
Identical sequences ENSCHOP00000007638 ENSCHOP00000007638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]