SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000007766 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000007766
Domain Number 1 Region: 68-249,341-515
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 7.59e-48
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0084
Further Details:      
 
Domain Number 2 Region: 673-882
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-36
Family YWTD domain 0.0000214
Further Details:      
 
Domain Number 3 Region: 1471-1656
Classification Level Classification E-value
Superfamily Fibronectin type III 1.45e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 1108-1146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 1235-1272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 1280-1316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 7 Region: 988-1026
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1151-1184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 1382-1419
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 1422-1461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 11 Region: 1661-1786
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000546
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 12 Region: 1029-1067
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 1188-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 14 Region: 1755-1870
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000102
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000007766   Gene: ENSCHOG00000008747   Transcript: ENSCHOT00000008799
Sequence length 2126
Comment pep:novel genescaffold:choHof1:GeneScaffold_3738:2320:136051:1 gene:ENSCHOG00000008747 transcript:ENSCHOT00000008799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTLHDGSAPLPQDRGFIVVQGDPRGLRLWARGDARGASGADEKPLRRRRSAPQQPEPIKV
YGQVSLNDSHNQMVHWAGEKSNVIVALARDSLALVRPRSSDVYVSYDYGKSFKKISEKFN
FGPGNSSEAVISQFYHSPADNKRYIFADAYAQYLWITFDFCKTVQGFSIPFRAADLLLHS
KASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSG
YSTVFHSTDFFQSRENQEVILEVKDFQLRDYMFATKVXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKG
GTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNFQLRRMPILSKESAPGLIIAT
GSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIIVAIAQGMETNELKYSTNE
GETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKEDVHSWLILQVNATDALXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXENEFILYATRKSIHRYDLASGVTEQLPLSGLRAAVALDFDFERNCLYWSDL
ALDIIQRLCLNGSTGQEVIISSGLETVEALALEPLSQLLYWVDAGLKKIEVANPDGDFRL
TIINSSVLDRPRALVLVPQEGIMFWTDWGDLRPGIYRSHMDGSTVHRLVSEDVKWPNGIS
VDAQWVYWTDAYLDCIERITFSGQRRSVILDSLPHPYAIAVFKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXNTCLRSQYRCSNGNCINSIWWCDFDNDCGDMS
DERDCPTTICDLDTQFRCQESGTCIPLSYKCDMEDDCGDNSDESHCXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVSHTCEASNFQCHNGHCIPQRWACDGDSDCQDG
SDEDPVNCEKKCNGFHCPNGTCIPSSKHCDGLHDCSDGSDEQLCEPLCTHFMDFVCKNRQ
QCLFRSMVCDGINQCRDGSDEDATFAGCSQDPEFHKVCDEFSFQCQNGVCISLIWKCDGT
DDCGDYSDEANCENPTEVPACSRYFQFQCENGRCIPSRWKCDGENDCRDWSDEKDCGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNATTTSSTRL
GRCDRFEFECQQPKKCIPNWKRCDGHRDCQDGQDEDNCPTHSTLTCMSREFKCEDGETCI
VLSERCDGFLDCSDESDERACSDDLTVYKVQNLRWTADFSGDVTLTWTRPKKMPSASCVY
NTYYRVVGDGIWKALETHSNKTNTILRILKPDTTYQVKVQVQCLSKVYNSNDFVTLRTPE
GLPDAPQNLQLALQREAEGVIVGHWSPPAHTHGLIREYIVEYSRSDSKVWASQRAASNFT
EIKNLLVNALYTVRVAAVTSRGIGNWSDSKSITTMKGKAIPPPDIHIDSYSENSLSFTLT
MDSDIKVNSYVVNLFWAFDTHKQEKRTLTFRGSTLSHEVGNLTAHTSYELSAWAKTDMGD
SPLAFEHFMTKGTRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSF
RTSLHNQTVIVGRDEQYLFLVRVVVPYLGPSSDYVVVKMIPDSRLPPRHLHAVRTGKTSA
VIKWESPYDSPDEDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDMSAS
QATQSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQNSFTAFANSHYSSRLGSAIFSS
GDDLGEDDEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences ENSCHOP00000007766 ENSCHOP00000007766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]