SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008113 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008113
Domain Number 1 Region: 417-596
Classification Level Classification E-value
Superfamily SPOC domain-like 1.02e-49
Family SPOC domain 0.00032
Further Details:      
 
Domain Number 2 Region: 43-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-30
Family Canonical RBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008113   Gene: ENSCHOG00000009175   Transcript: ENSCHOT00000009194
Sequence length 598
Comment pep:novel genescaffold:choHof1:GeneScaffold_6814:2373:4169:1 gene:ENSCHOG00000009175 transcript:ENSCHOT00000009194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVGLSRERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRATRNLFIGNLDHSVSEVEL
RRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGK
ANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKM
RGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLPDGYTRHRNLDADLRVRDRT
PPHLLYSDRERTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGGDGDRGVPKPSWE
ERRKRRSLSSDHGRTAHSPYEERNRTKGGGQQLERSSDRTPERSRKENHSSEGTKDSSSN
SLSNSRHGADERSHHHHHEAPDPSHGKKMRDGERNHRTAEAEPKLLEEPKHETKKLKNLS
EYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISGLLKDHTSGSKLTQLKIAQRLRLD
QPKLDEVTRRIKQGSPNGYAVLLATQATPSGPGTEGMPVVEPGLQRRLLRNLVSYLKQKQ
AAGVISLPVGGSKGRDSTGMLYAFPPCDFSQQYLQAALRTLGKLEEEHMVIVIVRDTA
Download sequence
Identical sequences ENSCHOP00000008113 ENSCHOP00000008113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]