SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008630 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008630
Domain Number 1 Region: 2356-2613
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-42
Family YWTD domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 1713-1979
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-40
Family YWTD domain 0.0000653
Further Details:      
 
Domain Number 3 Region: 3165-3329,3357-3429
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-38
Family YWTD domain 0.0000181
Further Details:      
 
Domain Number 4 Region: 2049-2302
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-36
Family YWTD domain 0.000028
Further Details:      
 
Domain Number 5 Region: 364-621
Classification Level Classification E-value
Superfamily YWTD domain 1.6e-21
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 6 Region: 4160-4287
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-18
Family YWTD domain 0.00029
Further Details:      
 
Domain Number 7 Region: 678-803
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000183
Family YWTD domain 0.00079
Further Details:      
 
Domain Number 8 Region: 1232-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000103
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 9 Region: 1032-1070
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 11 Region: 185-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000114
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 3763-3800
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 1075-1111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000128
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 2993-3034
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 15 Region: 2953-2993
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 72-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 3476-3512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 3111-3158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000082
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 19 Region: 2823-2862
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 20 Region: 3719-3759
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 21 Region: 1116-1152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 990-1028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 23 Region: 3686-3721
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 24 Region: 3806-3842
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2665-2702
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 1193-1230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 27 Region: 3891-3928
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 151-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 3036-3075
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 30 Region: 3514-3555
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 31 Region: 1320-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000991
Family EGF-type module 0.012
Further Details:      
 
Domain Number 32 Region: 1153-1191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 116-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 233-276,319-353,626-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 35 Region: 1357-1396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000379
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 36 Region: 1986-2034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.02
Further Details:      
 
Domain Number 37 Region: 3077-3124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000972
Family EGF-type module 0.013
Further Details:      
 
Domain Number 38 Region: 2779-2825
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 39 Region: 3643-3680
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000105
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 40 Region: 2910-2951
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 41 Region: 1276-1313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 42 Region: 3848-3886
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 43 Region: 3973-4006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 44 Region: 34-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 45 Region: 2749-2783
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 46 Region: 3935-3974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 47 Region: 4341-4375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000754
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000008630
Domain Number - Region: 2308-2352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000212
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 3551-3581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number - Region: 948-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1668-1711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00806
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 3434-3494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 2621-2660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0283
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 1405-1464
Classification Level Classification E-value
Superfamily YWTD domain 0.0288
Family YWTD domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008630   Gene: ENSCHOG00000009670   Transcript: ENSCHOT00000009775
Sequence length 4601
Comment pep:novel genescaffold:choHof1:GeneScaffold_887:11753:124455:-1 gene:ENSCHOG00000009670 transcript:ENSCHOT00000009775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVSGSFRCGDGRCIYASWRCDGISDCSDNSDEMNCPPHSCLSDEFRCWDCIPQSWVCDGE
DDCSDASDERQQCHPVTCSSHQMTCASGECVPIEYRCDHVKDCTDGTDEKDCQYPTCEQF
TCANGACYNMTQRCDGNLDCRDSSDEANCTQLCGHDEFHCASGECIPKTFACDHNSDCRD
GSDEYFCTYQTCRGNQFTCPSGQCISQNWVCDGEDDCKDNADENGCDSSHHRKCYPREWA
CPGSEKCISIEKVCDGQVDCPGGEDETNTTAGHQCXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFNDCQIWGVCDQICEDRVGHHQCRCVEGYILEHQRYCRAHSSSG
EATVIFSNGQDLLVGNIQGNSFQVLVHPEGRGKAVGVDFHYDLRKVFWTDVMRGKVFSVH
INGLNLQEVLNVSVDAAENLAVDWVNDKLYVVETTVGRIDLVNLDGSHRVSLITENLRQP
RGIALDPTVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRVY
WVDARFDYIDTVTYDGLQRKTVVQGGSAIAHPFGISLFEGHVFFTDWTKMAVLKANKFRD
TSPQVYHQSTLQPYGVTVYHALRQPRVRNPCENNNGGCEQVCVLSHITDNNGLGYRCRCK
IGFELAGDNHRCVAVKNFLLFSSKMSVRGIPFSTYRNEDVMIPVTESPSLFVGIDFCAEM
NSVFFSDRLGDVIAKQKTDGTGREILVPNRVDGVDSLSFDWISKNLYWTDSIYGAISVLR
LADKSRRTIIRHLDSPQSIVVHPIMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAYFTDWR
LKAIVRVRKTDGGARTIIRRDIDEIMLVKAYDANIQTGSNACNRSSNPNGDCSHFCFPVP
NFQRVCECPLGMKLSSNHLTCVNDSSSQPPVEQCGNFSFTCKNGRCIPSEYRCDGVDNCQ
DNSDEQECGLFNNTCSPMAFTCGHGHCIPLQWRCDRFTDCVDGSDEQNCPNQGAASCPPN
LYTCDNNHCIPKLWVCDTDNDCGDGSDEKNCASEDACQFNQFKCPGHRCIALSYVCDGDR
DCADGADEVGCVYNCTASQFKCASGDQCISNINHCDGVYDCRDHSDEIGCPRPPGMCHPD
EFQCQADGSCIPKTWECDGHPDCIQGSDEHPGCPPSTCPESRFRCDNGICISKMWLCDGD
NDCGDMSDERDCPTQPFQCSSGQWQCPDHNICVNLTAVCDGVADCPNGADESPLCNQQNC
IHDNGGCTHDCLQGPFGAECKCPLGFLLASDLKTCEDINECDTPGFCSQHCYNEIGSFRC
FCDEGYALEGDRRTCKVAGSDSLLLLVTNKNQIVADNITFHTQNIYPLVENGSHIVAIDF
DSISGRIFWSDRIEDKIWSAFQNGTDRKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSCAYAPCSHLC
LLSSQGPRFYSCACPSGWSLSHDSVNCLKDEQPFLITVRQHVIFGISLNPVEKSNDAMVP
IAGLQNGDDADFDDTEHFIYWIENPGEIHRVKTDGTNREVFAPTTILGSPMSLALDWISR
NLYYTNPGSHSIEVLTLKGDLKYRKTLITNDGTTLGTGLPIGITIDPARGKLYWSDQGTG
SGVPAKIASANMDGTALKTLFTGNLEHLEFITLDIEEQKLYWAVTSTGVIERGNVDGTNR
MILVHHLSHPWGIAVYDSFLYYADYDYETIERVDKNTGNNKIVLRDNVPNLRCLRIYHRR
NSADSTNGCSNNVNACQQICLPVPGGLFSCACASGFILNPDNRTCSPHSSFIVVSMLTAI
KGFSLDLSDHGEAMVPVAGQGRNALHVDVDVHSGFIYWCDFSNSVVFLNAIRRIKPDGSS
FTNIVTTGIGENGVRGIAVDWIAGNLYFTNAFRSETLVEVLRINTTHRRVLLKTTVDMPR
HIIVDPKNRYIFWADYGQNPKIERALLDCTNRTVLVSTGIVTPRGLAMDRSTGFIYWVDD
SLDIIARVHLNGGPSEMIRYGSQYPTPFGITVFGNSIIWVDRNLKKIFQASKQPGNTELP
RVLRDNINLLRDVTMFDPQVQPRSPAEVNNNPCLENNGGCSHFCFAMPGLQAPKCGCAFG
TLQGDGKSCAISTENFLIYALENSLRSLHLDPENHSPPFSAIQVESTIADLEYDSINNRI
YFTQNGHGHGQISYINLFSGIHSATVIASDIGIADGIAFDWINNRIYYSDFLNQTINSMA
VDGSQHTVIARVPRPRNIALDVCQGYMYWTDWGNTPKIERATLGGNFRAQIVNSSLVWPN
GLTLDFEEKLLYWADASLRKIERCTLTGMDREVVVSTMLHPFALTVYGQYIYWTDLFTKG
IYRANKYDGSGQMVMTMNLPRQPTAIHIRDKGQQQQCSNPCSQFNGGCSHICAPGPNGAE
CQCPSEGHWYLANNNKHCIADSGSRCNGSQFTCFNGHCISEQWICDNHDDCGDGSEELEI
VCAFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTCNNGRCI
SLQHVCNGINDCHDNGTSDEKNCPDFTCQPGYVKCQNTNVCIFHRYLCDGDNDCGDMSDE
NPTYCASQTCAVSDFRCTSGRCIPGHWYCDEERDCSDGSDEPASCXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRTCSSSEFFCEHSKSSSRRCIPRFWVCDG
EADCSDADDENQNCTRRTCSANEFTCRNGLCIRNTFRCDWRNDCGDYSDERECSYPTCSE
TQFTCQNGRCIPKAYTCDGDNDCGDESDELEHLCSTPEPTCPPHQFRCDNGHCIEMEKIC
NHIDDCGDDTDERGCGINECNDPSISRCDHKCTDTQTSFYCSCNPGYKLMSDKRSCDDID
ECKETPSVCSQMCENTEGSYICKCAPGYIRESDGKSCRQNSDITPFLIFSNRYYLRNLTL
DGQFYSLILQGLSNVVAMDFDRVEKRLYWFDVQRRVLERMFLNGTNRETVMRDNLPNAEG
LAVDWVGRKLYWLDAHLNCLSVADLSGRYRRKLAEHCVDANNTFCFENPRGIVLHPQYGH
IYWTDWARRAYIGRIGMDGTNRSVIISTKXXXXXXXXXXXXXXXXXXXXXXXXXXXYSDL
EGHNRHMVYDETLPHPFAITIFEDTIYWTDWNTRTVEKGNKYDGSGRMVLVNTTHRPFDI
HVCHPYRQPFVNNPCGTNNGGCSHLCLIKAGGQGFTCECPDNFKAIRVGEGTHCLPMCAS
TQFLCADNEKCIPIWWKCDGQRDCADGSDEPSLCPLRYCQLGQFQCTDGNCTSSYSLCNT
RRDCPDGSDEDQILCENHHCASNQWQCANKRCIPEFWQCDXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPAYRCDNHTEFSCKTNYRCIP
QWRVCDGRNDCIDNSDEQGCETMTCDPVGDFRCNDNVCIPLRWKCDGNHDCSDGSDEENC
VPRECTESEFRCHNQHCIPFVWICDHDNDCEDNSDELDCEMRTCQPGYFQCGSGHCVPEQ
LKCDGLPDCLDASDEATCPTRFPNGAYCPPTKFECKNHVCVEPAWKCDGDNDCGDGSDEE
LHLCLDVPCDSQFRFRCDNNRCIYSHRLCNHVDDCGDGSDEKEEHCRPPTPRPCTEDEFK
CNNGHCIAQNLVCDDVDDCGDRFDETGCNVGKERTCAENLCEHNCTQLSGGGFICSCRPG
YRASTSDRNSCIDINECEEFGVCPQKCKNFKGSYECLCAEGFVSMGEPKGKRCAAAGNAP
LLLLPDNVRIRKYNLSSDKFSDYLEDEEHIQAIDYDWDPEGVVYYSVLGQGTRFGSIKRA
YIPNVETGGHNMVQKVDLNLKYILQPDGLSVDWVGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXFMYWTDWGSEPKIERAWMDGQNREVLISTDLGWPTGLSVDY
LSKDRLYWTDLKEDVVESIKHDGTDRRIISNEGYPYSLDIFESQLYWVSKGKGEVWKEDK
FGKEQKVKVLTVNPWLTQVRIFHQHRYNQSVPNRCKDVCSHLCLLKPAGYSCACPQGSSF
KEGSTTDCDAAIEPPVAMPLACRCMYGGTCYYDESGIPKCKCSDGYTGSYCEVAFSKGMS
AGTTAMVTLLTIILILIIGALVIGGFFRYRRTGTLLPSLPKLPSLSSLVKSSENGNGVTF
RSGMDVNMDIGASGLGFETDIDKSMAMXXXXXXXXXXXXXXXEAPMVIVTVSGNVDNQNY
ETPVNLSELAPEMMQTSSGAGGTQATKWSFFKRKPKQDTNFENPIYGEKEKQQMDDGAES
PPLSAPLPAEMPPRREPTAGYSATEDSFKDTVNLVREDLEV
Download sequence
Identical sequences ENSCHOP00000008630 ENSCHOP00000008630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]