SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009184 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009184
Domain Number 1 Region: 2125-2316
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.46e-51
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000107
Further Details:      
 
Domain Number 2 Region: 613-721
Classification Level Classification E-value
Superfamily Second domain of FERM 1.15e-33
Family Second domain of FERM 0.00021
Further Details:      
 
Domain Number 3 Region: 1024-1130
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-27
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 4 Region: 723-829
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-26
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 5 Region: 1446-1551
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-21
Family PDZ domain 0.046
Further Details:      
 
Domain Number 6 Region: 1338-1410
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.000093
Further Details:      
 
Domain Number 7 Region: 519-612
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.72e-16
Family First domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009184   Gene: ENSCHOG00000010342   Transcript: ENSCHOT00000010398
Sequence length 2440
Comment pep:novel genescaffold:choHof1:GeneScaffold_5509:5:113532:1 gene:ENSCHOG00000010342 transcript:ENSCHOT00000010398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAESLELRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQS
LTSLSDVEKIHIYSLGMTLYWGADHEVPQSQPIKLGEHLNSILLGMCEDVIYARVSVRTV
LDACSAHIRNTNCAPSFSYVKQLVKLVLGNLSGTDQLSCNSEQKPDRSQAIRDRLRGKGL
PTGRSSTSDVLDTHKSPFSHQTFLNKGLSKSMGFLSIRDTQDEENYFKDISSDNSRHEDT
ENICSPYQFKTSGTEREVTSGIDVLPKKKIWASSMDLLCTADRDLSSREIGRYRHCLPEA
VTVRTSTAPRRKEARYSDGSIALDIFGPQKMDASCHTRDLPTSSAISSALDRIRERQKKL
QVLREAMNVESSDSDFRQVRRSEASKRFETSSGLPGVDETTSQGQSQRTSRQYEAPFEGN
LINQEIMLKRQEEEMIQLQARMALRQSRLSLYPGDTIKASMLDITRDPLREMALETAMSQ
RKLRNFFGPEFVKMTIEPFISLELPRSILTKKGKNEDNRRKVNVMLLNGQRLELNCDTKT
ICKDVFDMIVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKSKATV
NFTLFFRIKFFMDDVSLIQHTLTCHQYYLQLRKDILEERMRCDDETSLLLASLALQAEYG
DYQPEVHGVSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKICQR
LTEYGVHFHRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKK
ITLQNTSDGIKHAFQTDNSKVCQYLLHLCSFQHKFQLQMRARQSNQDAQDIERASFRSLN
LQAESVRGFNVGRAISTGSLASSTLNKLAIRPLSVQAEILKRLSCSELSLYQPLQNSSKE
KSDKASWEEKPRGMSKSYHDLSQASVSPHRKNVIVNKESPPQTIEELVGGPVHQMARADT
ESLAGFTKLNNSKSVASLNRSPEKRKHESDSSSFEDPGQAYVIGMTMHSSGNSSSQGPLK
ENDVLYKRWSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSITPGGPA
DLDGCLKPGDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVRL
ANGMKNYMKKASYMQDSAIDSSSEDHHWPHGTLRHISENSFGLPGGLREGSLSSQDSRTE
SASLSQSQVNGFFTSHTGDRTWQESQHGSPPPSIIATASEKKRTSTDSSQSKAKKTGISD
VPDCSDRGDSDMDEATYSGSQDHQTPKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSL
EGATHKQAVETLRNTGQVVHLLLEKGQSPVSKEHVPGTPQCTLADPDAQGQPPEKTVKKM
THVKDYSFVTEENTFEVQLLKNSSGLGFSFSREDNLIPEQIHTSIVRVKKLFPGQPAAES
GKIDVGDVILKVNGASLKGLSQQEVISALRGTSPEVSLLLCRPPPGVLPEIDSALLSPLH
APAQVLPNSTKDPSQASCVEQGNSSDENEMYDKSNKNCKSPSRRDSYSDSSGSGEEDLAK
APTKTSNISWDSALRQSLSSMLSQTQSRHEVPKSREDTICTMFYCPQEIPNKPEFEDSNP
PSPLPLDVTPGQSSQPQSEYTSFNSMDKYIYHTSEPTGKGGLTALKNDLENHLEDFEMXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXHHCVEPCDKPALPPNNSFSKVNGEGIMEVSHPEGKCC
IYQMKESAKLTLPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVVKTNGKLSEERAEDTDCDGSPLPEDFTESTKINGCEDCCEEKVVNESLIQKSQERKPD
EDEITWGSVELPIETTTHEDSSKDYPFLTDEELAALPIVKVLPSGKYTGTKLKSVIRVLR
GLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDDGGYINA
SFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPN
ILGKTTMVSDRLRLALVQVQQLKGFVMRAMTLEDIQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXDQYIFCYQVILYVLTRLQAEEEQKEQQQHLK
Download sequence
Identical sequences ENSCHOP00000009184 ENSCHOP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]