SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009317 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009317
Domain Number 1 Region: 1251-1427
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-25
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 869-1005
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000000393
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1071-1117
Classification Level Classification E-value
Superfamily PH domain-like 0.00000216
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009317   Gene: ENSCHOG00000010507   Transcript: ENSCHOT00000010556
Sequence length 1429
Comment pep:novel genescaffold:choHof1:GeneScaffold_4962:4249:58039:1 gene:ENSCHOG00000010507 transcript:ENSCHOT00000010556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGPKPPIAPKPRLAAPNEWRASVYMNNSLNKCSNGKLLCMDRGPCEGLRPTEANEDYI
VAPRAVPREDGPADQGCTGGEAPEEEHGQPSEQCDTEGTGAAEDPAAPTEVVLSGECSEG
VGEEGRENEPGEGEPACTSEEEEKLVKEHKVYNLEDRGTWDGEVFQSEIILTHVDLGDLG
APETPREVEEVGEKGCANAEPDVRADSDGSPEEDAGDSSREAPENEEMATDAQEAGVALG
NTEISEECEDGTGGPGEEQPDQDEKPDKKVPQEVGGDPREGEDPVKEEPAEESCHIVPFE
NDGIDDFVASLTGSPYEFFPTESTSFCSESYSPLSKLAKGLEAEQKLKSGVCAQEASGAG
PSAGRHGSLEDGACEDPSVPDVVVLPKGAPDEEVADDALTNPYVMGVGLTCLADHLLPGE
REPSEMQVGSDVLDGYGTKEEMNSDAENSLLPIDRINLVTRTRPHSGKVAGYVPETVPEE
TGIEAGSSAIGSGGAIEEARKTASSLEGKPLEASRALPAKPRAFTLYPRSFSVEGREIPF
SLYREPEGSGLEDHRIKRKEDNLSLPCVIGSSGSFSQRNHLPSSGTSTPSSVVDIPPPFD
LACITKKPITKSSPSLLIESDSPDKHTKKKKSSFKRFLALTFKKKTESKVHVDVNVSSSR
SSSESSYHGPARILEIDRRSLSNSPQLKSRTGKLRACESPSSLIFYRDGKRKGVPFSRTV
SRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQIPPRRPARAGT
FTKLFEDQSRALSTANENDGYVDMSSFTPFESKQQSTDQETEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVEGQSRAHVIAQELLSSEKAYVEMLQHLHLXXX
XXXXXXXXXXXXXXXXXXXXXEVRLGQSRLPAIHELHWGILEELDERLFNWEGQQKVADI
FLARELGFDHHAAHILQFDRYLGLLSENCLHSPHLAAAVREFEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXAQXXXXXXXXXXXXXXXXXXXXENLQKLVHIEH
SVRGQGDLLQPGREFLKEGTLMKVTGKNRHPRHLFLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYLKDRMAKV
CDGCYGELKKRGGDIPGLPRERPVSMSFPLSSPRFSSSAFSSVFHSINPSTFKKQKKVPS
ALTEVAASGEGSAISGYLSQCRKQRHWKKLWFVIKGKVLYTYMASEDKVAMESMPLLGFT
IAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRWVEAMEDASVL
Download sequence
Identical sequences ENSCHOP00000009317 ENSCHOP00000009317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]