SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009684 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009684
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 176-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000213
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 310-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000261
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 273-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000924
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009684   Gene: ENSCHOG00000010932   Transcript: ENSCHOT00000010967
Sequence length 411
Comment pep:novel genescaffold:choHof1:GeneScaffold_7620:5584:17123:-1 gene:ENSCHOG00000010932 transcript:ENSCHOT00000010967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKTQESLTFDDVAVEFTWEEWQLLGPAQKDLYWDVMLENHSNLVSLGYQARKLYVLLGW
EQGEQPWTVVEIHSQIHPEIEKVNNYLPGNSQNQRMLKRMEQCYEHAITLKSYLHFVNQN
KSYVIKAPADCNGNGKSFLHDNHEQTHTENKFCESRKPISIKAQLLNQQKTEKIEKTHEC
IECREAFIKKPKLSQHKRIHTREKPHGCSECGKAFLKKFQLREHKKTHVGQKPHVCSFCG
KAFYRKFTLTEHQRTHTGEKPYKCTVCATVFRRRELIIHQGNEKGGKPYGCSECRKHFSS
KSQLTVHKIHTGERSHICTGCGKAIITKQQLIINQRTDTGERLYECIQCGKAFAYKSCLT
KYKHTENHVDSGSSPQKQFTTYKNPVNTENPCYCGACADAFSPQTIKHQWA
Download sequence
Identical sequences ENSCHOP00000009684 ENSCHOP00000009684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]