SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009734 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009734
Domain Number 1 Region: 350-425
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.65e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000634
Further Details:      
 
Domain Number 2 Region: 161-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000178
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000581
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000009734
Domain Number - Region: 118-152
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number - Region: 294-344
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.1
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009734   Gene: ENSCHOG00000010987   Transcript: ENSCHOT00000011024
Sequence length 572
Comment pep:novel genescaffold:choHof1:GeneScaffold_1727:4826:52947:1 gene:ENSCHOG00000010987 transcript:ENSCHOT00000011024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPL
DDGVGNQLGALVHQRAVITEEFKVPDKMVGFXXXXXXXXXXXXXXXXXXXXXXXXXSSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDIDGNSTIQEILIPASKVGLVIGK
GGETIKQLQERTGVKMVMIQDGPLPTGADKPLRITGDPFKVQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGISPERA
AQVMGPPDRCQHAAHVINELILTAQERDGFGGLAVARGRGRGRGDWSVGTPGGMQEITYT
VPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNTDPNLRIFTIRGIPQQIEVARHL
IDEKVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAASAAPQASSP
PDYTMAWAEYYRQQVAFYGQTLGQAQAHSQEQ
Download sequence
Identical sequences ENSCHOP00000009734 ENSCHOP00000009734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]