SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009895 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009895
Domain Number 1 Region: 50-213
Classification Level Classification E-value
Superfamily L domain-like 7.23e-40
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 448-754
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.68e-35
Family Rhodopsin-like 0.01
Further Details:      
 
Domain Number 3 Region: 245-379
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000102
Family Ngr ectodomain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009895   Gene: ENSCHOG00000011170   Transcript: ENSCHOT00000011210
Sequence length 813
Comment pep:novel genescaffold:choHof1:GeneScaffold_3941:6449:79560:1 gene:ENSCHOG00000011170 transcript:ENSCHOT00000011210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSMNNISQLLPNPLHNLRFLEEXXXXXXXXXXXXXXXXXXXXXXXXXMLQNNQLRQVPT
EALQNLRSLQSLRLDANHISYVPPSCFSGLHALRHLWLDDNALTEIPVQAFRSLSALQAM
TLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKSFDGLHSLETLDLNYNHLDEFPT
AIRTLSNLKELGFHSNNIKSIPEKAFVGNPSLITXXXXXXXXXXXXXXXXXXXXXXXXXK
RASQITAFPDLTGTASLESLTLTGAQISSLPQTVCDQLPNLQVLXXXXXXXXXXXXXXXX
XXXXXXRSMNLAWNKIAIIRPNVFFTLPSLIKLELSSTRLSSFPVTGLHGLTHLKLTGNH
ALQSLISSENFPELKVIEMPYAYQCCAFGVCENVYKISNQWNKGDNNSADDLYKKDAGMF
HAQDERDLEEFLFDFEEDLKALHSVQCSPSPGPFKPCEHLFGSWLIRIGVWTIAVLTLTC
NALVASTVFRSPLYISPIKLLIGLMAVVNMLMGVSSSVLAGVDAFTFGSFARHGAWWEKG
VGCQVIGFLSIFASESSVFLLTLAALERGFSVKCSAKFETKTPFSSLKAIILLCAGLALT
IATVPLLGGSEYSASPLCLPLPFGEPSTTGFMVALVLLNSLCFLVMTVAYTKLYCNLEKG
DLENIWDCSMVKHIALLLFTNCILYCPMAFLSFSSLLNLTFISPEVIKFILLVIVPLPAC
LNPLFYILFNPHFKEDLGSLGKQTHIWTRSKHPSLISINSDDVEKQSYDSTQALVTFTSA
SIAYDLPSNSVSSPAYPMAESCHLSSVTFVPCL
Download sequence
Identical sequences ENSCHOP00000009895 ENSCHOP00000009895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]