SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010179 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010179
Domain Number 1 Region: 206-409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.39e-41
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 771-950
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.68e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 576-766
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-35
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 4 Region: 983-1164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.9e-34
Family Laminin G-like module 0.00000108
Further Details:      
 
Domain Number 5 Region: 25-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-31
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 6 Region: 420-552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.46e-21
Family Laminin G-like module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010179   Gene: ENSCHOG00000011499   Transcript: ENSCHOT00000011543
Sequence length 1466
Comment pep:novel genescaffold:choHof1:GeneScaffold_212:13592:334299:1 gene:ENSCHOG00000011499 transcript:ENSCHOT00000011543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTFHSAFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAEMAVLSNKQVNDSSWHFLMVSRDHLR
TVLVLDGEGQSGELQPQRPNMDVVSDLFLGGVPADIRPSALTLDGVQAMPGFKGFILDLK
YGNSEPRLLGSQGVQLDAEGPCSERPCENGGICFLLDGHPTCDCSTTGYGGKLCSEGSGX
XXLSHLMMSEHAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK
SADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGI
LTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSR
LARIGDTKMKIYGDVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPN
GLILFTHGKPQERKDPRSQKNTKVDFFAVELLDGNLFLLLDMGSGTIKVKATQKKANDGE
WYHVDIQRDGRSEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKDGWNRFICDCTGTGYW
GRTCEREASILSYDGSMYMKIVMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSADTLR
LELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKSLKLTVDDD
VAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGPLYIDLCKNGDID
YCELKARFGLRNIIAEPVTFKTKSSYVSLATLQAYTSMHLFFQFKTTSADGFILFNSGDG
NDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKVDTKV
VTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRLPDLINDA
LHRSGQIERGCEGPSTTCQEDSCANHGVCMQQWEGFTCDCSMTSYSGNQCNDPGATYIFG
KSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGV
VFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHYPTGRQLTIFNTQ
AQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTQT
TSMPPEMSTTLMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTD
KSLSTSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRFTASSSSGMVPKLP
AGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRVPGA
SEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNG
SLIKEKQQSSKSGHRKQKNKDKEYYV
Download sequence
Identical sequences ENSCHOP00000010179 ENSCHOP00000010179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]