SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010649 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010649
Domain Number 1 Region: 149-259
Classification Level Classification E-value
Superfamily C-type lectin-like 7.59e-42
Family Link domain 0.0027
Further Details:      
 
Domain Number 2 Region: 3130-3288
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-38
Family C-type lectin domain 0.00000518
Further Details:      
 
Domain Number 3 Region: 252-350
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-28
Family Link domain 0.0032
Further Details:      
 
Domain Number 4 Region: 3289-3347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 3086-3127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000132
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010649   Gene: ENSCHOG00000012043   Transcript: ENSCHOT00000012080
Sequence length 3391
Comment pep:novel genescaffold:choHof1:GeneScaffold_308:11261:99001:1 gene:ENSCHOG00000012043 transcript:ENSCHOT00000012080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINIKGLLWMCSTLIATHALHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVFHYRAATSRYTLNFEAAQKTCLDNGAVIA
TPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRTPREGCYGDMMGKEGVRTYGFRSPLETYD
VYCYVDLLDGDVFHVTAPDKFTFEEAGEACENEDGRLATVGELHAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPTPDSRFDAYCFKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDFTDSYQDTTKY
DGGITPVHLTHSALNMEVVTVSKWSRDEDNITSMPLVSTKHEGSPKLSPALLTTVEVNGK
DEESPGFTEHGRDEYTLILDSTQKPLEKFTEYYLREHGKFTVGFQPTASNGIAEKSTLRD
STTEERIPSITRTEGQVVYATTEGSASGEGPDVDISKSVSTVSQFAHTSEVEGLAFVNYS
STQKPTAYVETSHTVPLSVIPKKEWGVLIPSVPSEGEVLGEPSQDIHIIDQTHLEAAIST
ETIRTTTEIAQGRTQEEFPWEEQTAEQPVAAPSSTDGMPMEATTPLDEQERNGSAYPFSE
ESLVTGSERVSVLDTTPDGKMEHSMSYPPGAVTEHKVKMDEMGTLLPSMGPRVSLGPGPE
KEFEIEGSSPWEFVSPLSPFSTRDSLLKEETTTEKREKTSVDYIDVGSGFFEKPKVTELP
EFSTIKVTVLSDITTVFSSVDKLHTTSATKLSSASTEKPPLIDREPGEGTTSDMVIIGES
TSRVPPATLDDIVAKETETDIDREYFTTSSTPTTQPTRPSTVEGKATFGPQTVSTPEPPK
GTKFHPDINVFIIEVRENKTGRMSDLSVIGHPIDSESKEEEPCSEETDAEHDLIDEILPD
LPEVIEIDIYHSEEDEEEDEDCANATDITTTPSVQYINGKHLVTTVPKDPEAAEARRGQF
ESVAPSQNFSDSSESDPHPFAMAETELSTAVQPNESKETTESFEITWKPETYPEAPEHFS
SGEPDVLPTVQFHEEEATEGTESVTKRGPELDSLVHKNTETVPLFPEESSGDAVIDQESQ
KMVFSRTTEVTFHEETEKSTSVTSAPSTASSSGAATISEEESTSLTGSPLPDDRLSTIEN
WLEITPRKIVELLGSPSIPSPEGSGEEEEDKNEMFTVAPDTSQKSTTNTLTTLDTGKRMI
TESILDVSATTIYSVSEQPSAEVVPAKFVKETDTPEWVFSTSLEGKKRNDEEEEKSPQTV
STDERHSPTQRSDQLILLSELESSSESPSSDLIYSTRKSVTSSTASTQSEKEMTSSTLVL
TESNVVDDFGAQATGQSSSSQPRVQEALTTAPSSPVSPFLEQSSGEAAVDPETTTLSSFS
LNLQPGIQTQKEATGTLSIHVENSFPFEPTGLVLSTVMDTQVAETISQTSKENLVSEVPG
EPNLGAEIRVFSTDFPLEEEFSGEFGEYSTVSHPIRKEEAIMMEGSGSSIFMDTQISTSA
IPTSDYINHIPDLERPSSTQVSTSAFPWEDFTTSAEGSGEQLESISSSVDQVLPSAKGKV
SGTDNPFIDQGLEEMIAVKEADKKSTILPMAEAQGTEAPTGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTTGQ
GSDTFVSDSSLEKLHEAPSTKAVSVDGFPTVSEVLPLHSEQNESFLDPSSTSAMSYEMST
EGPEGSFQDSFRGFEDSTLKPDRRKDTENIIIDLDKEDKDLILTITESTILDSLSDLTSD
KNAIIDIDHTTSVYEDILGMQTDTDAEVPSEPHSSNEEISQVQEKYETAVNLSLTEEKFE
GSGDALLSSYTQATHNESMISEDGSQLDHMGFITTGIPVPSIETELDFLLPTAASLSIPS
KSATVNPETDEPKIKAKTLDDIFESSTLSDGQAIADQSEIISTVGHLRRTQKYEEKKYVG
PSFQPEFSSGAEEALVDHTPYVSIGTYLMTQSLTEAPNVIERSNPPGYTETTPAVSASVK
LSSQMLPSPVTIQSGSGASEPTEVLEPSALPGTDVDTSQMSPEDSFKEAHATIEATFKPS
EDDFHITAPPSLSPDVEEESNLKIFEEVEASATELIAEEGTEVPQDSQNQTNVQLSGEAI
KEFIFIGTSEAETVVTSAGEIKLEGASQRPLSTSASATHGVEPSVVPQPDPQTSEGPTVP
SSLEINLKTQASLIRGEDSTVAAPEHQISARVLDSNNQVTESTVELSTEPTTPPFSLLET
SNETDFLIGINEESVEGTAVYLPVPDRCKTNPCLNGGTCYPTDTSYVCTCVPGYSGDQCE
LDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFA
HRRTWDAAERECRLPEDHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTL
KYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENA
KTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKK
YFKNSSSAKDNSINESKHDHRWSRRWQESRR
Download sequence
Identical sequences ENSCHOP00000010649 ENSCHOP00000010649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]