SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011048 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011048
Domain Number 1 Region: 25-242,512-596
Classification Level Classification E-value
Superfamily L domain-like 1.94e-48
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 2 Region: 666-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-38
Family Toll/Interleukin receptor TIR domain 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011048   Gene: ENSCHOG00000012476   Transcript: ENSCHOT00000012510
Sequence length 840
Comment pep:novel scaffold:choHof1:scaffold_4121:779:10974:1 gene:ENSCHOG00000012476 transcript:ENSCHOT00000012510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSPWRLAGTLIPAMAFLSCLRPESWDPCVEVVPNITYQCMEMNLYKIPNNIPSSAKNLD
LSFNPLRNLGNHSFSKFPNLQVLDLSRCEIQMIEDDAYQGLHHLSTLILTGNPIKRIALG
AFLGLSSLQKLVAVETNLASLEDFPIRHLKTLKELNVAHNVIHSFKLPVYFSNLPNLEQL
DLSNNQIRNIYHEDLQILQQMPLPQLSLDLSLNPIELIQPGAFKEITLHQLTLNNFNSTD
VMKTSIRGLAGLKIHRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSWGAFDSLLKLQVLNISHNKLLTLDMLHYK
HLHSLQILDVSFNGIEASESQELPQFPSSLALLNLTQNNFACTCEYQSFLQWVKDQRQFL
VEAEQMVCATPERMRGTPVLSFSNTTCQMSKTIISASVLSVLVVALVIVLFYKFYFHLML
LAGCKKYSGGENTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFHLCLHYRDFIPGVAIAA
NIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLQKIEKSLLR
QQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEETADAENSQPEATTST
Download sequence
Identical sequences ENSCHOP00000011048 ENSCHOP00000011048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]