SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011669 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011669
Domain Number 1 Region: 531-623
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.83e-36
Family Oxysterol-binding protein 0.0037
Further Details:      
 
Domain Number 2 Region: 756-868
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.07e-26
Family Oxysterol-binding protein 0.0063
Further Details:      
 
Domain Number 3 Region: 4-52
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000541
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 196-305
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000144
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011669   Gene: ENSCHOG00000013156   Transcript: ENSCHOT00000013214
Sequence length 876
Comment pep:novel genescaffold:choHof1:GeneScaffold_4904:15505:115171:-1 gene:ENSCHOG00000013156 transcript:ENSCHOT00000013214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSKSNLGWTPLHLACYFGHRQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKPLDLAQGAEM
KHMLTGNKVIYKALTRYEGPLWKSSRFFGWRLFWVVLEHGVLSWYRKQPVAVHNIYRQGC
KHLTQAVCTVKSTDSCLFFIKCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYCS
QDQLSDDEEEGAVSAVDMKESLAKAQACQERLDSEISNFLKMIKECDMAKEMLPSFLQKV
EVVSEASRETCVALSDCLNLFTKQEGVRNFKLEQEQEKNKILSEALENSESEQSLTRLEA
VTAHSFEEEGEHLSSRKNRMSEGKDCGGGDSLSNGIKKHRTSLPSPMFSRNDFSIWSILR
KCIGMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVAAFAVSAV
ASQWERTGKPFNPLLGETYELVRDDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIY
PKLKFWGKSVEAEPKGTITLELLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLSTSEESDEMPVPDSESVFVIPGSVLLWRIAPRPPNSAQMYNFTSFAM
VLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSEEDW
KTRWFHQGPNPYNGAQDWLFSGSYWDRNYFNLPDIY
Download sequence
Identical sequences ENSCHOP00000011669 ENSCHOP00000011669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]