SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011733 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011733
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 8.24e-36
Family Tubulin, GTPase domain 0.0000806
Further Details:      
 
Domain Number 2 Region: 258-344
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 5.8e-21
Family Tubulin, C-terminal domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011733   Gene: ENSCHOG00000013231   Transcript: ENSCHOT00000013285
Sequence length 345
Comment pep:novel genescaffold:choHof1:GeneScaffold_733:2633:18839:-1 gene:ENSCHOG00000013231 transcript:ENSCHOT00000013285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQSVVLQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRAVLIDMEEG
VVNEILQGPLRDVFDSKQLITDISGSGNNWAVGHKVFGSLYREQILEKLRKSAEHCDCLQ
CFFIIHSMGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSLFDIISKIDLMVNSGKLGTTVKPRSLVTSSTGSFKKRHKKPFDAMN
NIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYXXXXXXXXXXXL
DQMFSDAFSKDHQLIQANPKHSLYLACALMVRGNVQISDLRRNIE
Download sequence
Identical sequences ENSCHOP00000011733 ENSCHOP00000011733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]