SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011766 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011766
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily POZ domain 4.51e-25
Family BTB/POZ domain 0.00079
Further Details:      
 
Domain Number 2 Region: 772-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-22
Family Classic zinc finger, C2H2 0.00077
Further Details:      
 
Domain Number 3 Region: 706-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.59e-16
Family Classic zinc finger, C2H2 0.00083
Further Details:      
 
Domain Number 4 Region: 543-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000202
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 748-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000075
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 668-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000126
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000011766
Domain Number - Region: 907-942
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000209
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 1020-1050
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000702
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011766   Gene: ENSCHOG00000013283   Transcript: ENSCHOT00000013323
Sequence length 1051
Comment pep:novel genescaffold:choHof1:GeneScaffold_6483:6055:9643:-1 gene:ENSCHOG00000013283 transcript:ENSCHOT00000013323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAASSEYFQSLFT
NKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSGLAAVQELGYSLGISFLTNIVSK
TPQAPFPTCPNRKKFFIEDDESSSQKRSVIVCQSRNEAQGKTVSQNQLELSHTARSSPGT
AARTSTSPHAPEPIEPPHNLSLSEKSWPKDASVGYAKSLEHSGSLDDPNGSDLVKRNAVL
PSKPLPDREAAVDNKPGVSGQLPKGKAIELALKKPRPPVLLLRSSSEAPYLLKETNKGSG
QGEDRNLLYYSKLGLVIPSSGPGSGNQSIDKSGPLVKSLLRRSLSMDSQVPIYSPSLDLK
SSQVASSVLSDAPGNAFCALSQKSSLKPCGENPALEARTQALQPHRLRSFSASQSTDREG
ASPVTEVRIKTEPSSPLSDPSDIIRVTVGDAAAATGAASSSSATRDFALKREDDQKEMSR
LPAKRRFQADRRLPFKKLKVNERNSTTLELNFEGSSPALLDGDFPGSELNKDEFGELEGT
RPNKKFKCKHCLKIFRSTAGLHRHINMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGV
VKNPSPASGSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQASSQAQQVIKR
NLRSRAKGAYICIYCGKAYRFLSQFKQHIKMHPGEKPLGVNKVPKPKEHAPLASPVENKE
VYQCRLCNAKLSSLLEQGNHERLCRNATVCPYCSLRFFSPELKHAHESKCEYKKLTCLEC
MRTFKSSFSIWRHQVEVHNQNTMVPTENFSLPVLDHNGEVTGTSRPQPQSEPNKVNHVVA
TKDDNVFSDSSEQINFDSEDSSCLPEDLSLSKQLKIQVKEEPVEDAEEEAPETSAAPKET
SASKDASLWPCEKCGKMFTVHKQLERHQELLCSVKPFVCHCNKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSENPTLATEKLLYPKESDTLFYHAPPLS
AITFKRQFMCKLCHRTFKTAFSLWSHEQTHN
Download sequence
Identical sequences ENSCHOP00000011766 ENSCHOP00000011766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]