SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000012316 from Choloepus hoffmanni 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000012316
Domain Number 1 Region: 673-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 729-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 770-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000406
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 625-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000107
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000012316   Gene: ENSCHOG00000013904   Transcript: ENSCHOT00000013945
Sequence length 856
Comment pep:novel genescaffold:choHof1:GeneScaffold_5008:910:16131:-1 gene:ENSCHOG00000013904 transcript:ENSCHOT00000013945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEREAVSLVVHLEKETGRIQQVSSPVHSEKQAPLGTVWEVADYQPEQVETEPRVISREEP
GSLHLGCQEQLNHKREHRFLPKNAQPSPWVPAHAEEWNIRDQEVMTTHVPGGLQEPXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTGSVSSKIAQLEQRKEPWTIHL
HSSNKRKILQSNYIKEKSVHAVQISTRNAGKMWREQQQWGLEDEKIAGVHWSYEETKTFL
AILRESRFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHV
LEPCAFFEDMDALLNPAAQASSNNKPKEIISLPRLKRIGISAKEQISLVEEEEALEESDG
DEMGIELIRKSEIRGAPVLFQNLSGVHWGYEETKTFLDILRETRFYEALQACHRKSKLYG
VVAEQLRECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSRASAPST
SVPEEVSSPLRQEQGGFEIESEEPTDWEPEETSQEAIVEDSGSERMSEEEEIEQESEFQG
PMGLLQSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XQWENHQGIRQGKLMSQPRDLGKAVVHQRPFMGKRPYRLLRYGESFGKSARLMCRMTHQK
ENPYKCSVCGKCFGRSRSLIRHQRIHTGEKPFKCLECGKSFNDSSNFGAHQRIHTGEKPY
RCRECGKCFSQSSSLIIHQRTHTGEKPYQCGECGKSFTNSSHFSAHRRVHTGENPYKCVD
CEKSFNNCTRFREHRRTHAGEKPYGCAQCSKRFTKSSVLMKHREVHIREKLLPHPPSVFS
PENPHKGKTDEFRKTV
Download sequence
Identical sequences ENSCHOP00000012316 ENSCHOP00000012316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]