SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.201844|PACid:15700372 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aqu1.201844|PACid:15700372
Domain Number - Region: 10-44
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0589
Family Type I dockerin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.201844|PACid:15700372
Sequence length 50
Sequence
SRMSEKRKQLIANSKYLGGDMEHTHLVKGLDYALLQKVLWKVLNRFFRLR
Download sequence
Identical sequences Aqu1.201844|PACid:15700372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]