SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.202117|PACid:15700645 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aqu1.202117|PACid:15700645
Domain Number - Region: 224-252
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0143
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Domain Number - Region: 100-144
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0915
Family GntR ligand-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aqu1.202117|PACid:15700645
Sequence length 261
Sequence
MPPPSWLSELLGGALSSAPTATATPSLALASALPPIPGKAVDKISKGIFIEFKELLADNV
ALASQLRELGPVQGATARSRMRDISDPLSWVYCFLSYVVVLVPDPRLRDLVAYGQIVIQL
ARSHGGSGWLEYDRRFHQQVAAGAPLSWAEINPSLMSATVPGFGLASGSGNCPLCLSWDH
DRADCALASLDQQSKPPTHSKPYSRSPLEICRRFNAGVCPNSSNRCRFLHACSTCSKSGH
PAADCKESKGKAKAKSSPAPP
Download sequence
Identical sequences A0A1X7SLT9
Aqu1.202117|PACid:15700645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]