SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aqu1.202432|PACid:15700960 from Amphimedon queenslandica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aqu1.202432|PACid:15700960
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000275
Family Kelch motif 0.024
Further Details:      
 
Weak hits

Sequence:  Aqu1.202432|PACid:15700960
Domain Number - Region: 111-140
Classification Level Classification E-value
Superfamily SOCS box-like 0.0968
Family SOCS box-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aqu1.202432|PACid:15700960
Sequence length 167
Sequence
TPRWAKINTTGYQPPGRRSLQGIAYGEKSIIYFGGFSTRKKIFYSDLFILDTDTRHVLKV
IPFGLGPCPRRRVGMCLIGSDVIICGGVGRNQSKEKHDHSLLTFGDTYSLHLLPSLQHLC
IENIINYQLPVEILPVSIKQHIYTLSNEECSDTSVPKIITIKFFFSK
Download sequence
Identical sequences Aqu1.202432|PACid:15700960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]